ELF44 (444  TTTII. . @. . hhhDDPtdA A \\QtdRtd. . dd/lib/ld-linux.so.2GNUGNU yl"LJC(V2x~I9gOnHuYtG[5+'bo$0,i {}_j:pT;c|*hC<6U-LldP!%1/8@ JE KRDQA>f7]N(weW)"XqkrySm Za^s#4?` zM\v FB=&.3C 4DTB0PHJP [A $@\l@0"qd G S"L;_iM~r:JM?P(Y@uV?Ƃ dK> ŹQ{1ȁ ҙ=IEV,x@,BWIJ3 _>MoSLtUG+8pvXwK[q+S'` ;0xBJzlC۱dTo %yyIk#40PCER ;/xCh:P%m Cu|BNuTJ C'|f (ELaSkȻqXc0 z *sr C 7 # )se}} $c+^B/) 2`k GrP;X4  .q   s:4R0Yq R`DO<q #<p [ 8DJ? Rb& UX s u  SDD#=+ E `7 (!`  : (!6 !$6  ! 7 !(@:"` : !p=5 !@9 ,! T  ! 9  !w0  !Db  <  !_  !`` !7 ,!`09  !8 !F b  PUL !7  !O8 !L0 [9 (! 9 !O 87 !D 9 @!  !?5  !e  H:  !g@6  ![p8 !H  !6 @!0&   !uh !75 G  !s@P:%"* @6 JHJ  $  !{ y !g7    ! H8 !8 !h* !>5 ,8 ,!libicudata.so.42libicui18n.so.42_Jv_RegisterClasses__gmon_start___fini_initlibicuuc.so.42libstdc++.so.6pthread_cancel_ZTISt14overflow_error_ZSt20__throw_out_of_rangePKc_ZSt9use_facetISt8messagesIcEERKT_RKSt6locale__cxa_guard_abort_Znwj_ZNSs6appendEPKc_ZTISt15underflow_error__cxa_free_exception_ZNSt6localeaSERKS__ZTSSt14overflow_error_ZNKSs4findEcj_ZSt16__throw_bad_castv_ZNSs4_Rep9_S_createEjjRKSaIcE_ZNSsC1EjcRKSaIcE_ZTISt8bad_cast_ZNSt15basic_streambufIcSt11char_traitsIcEE8overflowEi_ZNSsC1ERKSs_ZNSo3putEc_ZNKSs5rfindEcj_ZSt18_Rb_tree_decrementPSt18_Rb_tree_node_base_ZNSt15basic_streambufIcSt11char_traitsIcEE5imbueERKSt6locale_ZNSt13basic_filebufIcSt11char_traitsIcEEC1Ev_ZSt19__throw_logic_errorPKc_ZNKSs7compareEjjPKc_ZNSt13basic_filebufIcSt11char_traitsIcEE4openEPKcSt13_Ios_Openmode_ZNSs12_M_leak_hardEv_ZNSt15_List_node_base4hookEPS__ZSt18_Rb_tree_decrementPKSt18_Rb_tree_node_base_ZNSs6assignERKSs_ZSt20__throw_length_errorPKc_ZTv0_n12_NSiD0Ev_ZNKSt8messagesIcE5closeEi_ZSt4endlIcSt11char_traitsIcEERSt13basic_ostreamIT_T0_ES6__ZNSt8ios_baseD2Ev_ZTISt9exception_ZTISt10bad_typeid_ZTv0_n12_NSt14basic_ifstreamIcSt11char_traitsIcEED0Ev_ZTVSt14basic_ifstreamIcSt11char_traitsIcEE_ZTISt15basic_streambufIcSt11char_traitsIcEE_ZNSs14_M_replace_auxEjjjc__cxa_rethrow_ZTVN10__cxxabiv120__si_class_type_infoE_ZTv0_n12_NSiD1Ev_ZSt4cout__cxa_allocate_exception_ZTISt11logic_error_ZTISt13runtime_error_ZNSs9_M_mutateEjjj_ZNSs3endEv_ZTSSt12domain_error_ZTv0_n12_NSt14basic_ifstreamIcSt11char_traitsIcEED1Ev_ZNSs7reserveEj_ZNSt15basic_streambufIcSt11char_traitsIcEE6xsgetnEPci_ZNKSt13runtime_error4whatEv_ZNSt15basic_streambufIcSt11char_traitsIcEE9underflowEv_ZTSSt16invalid_argument_ZTVSt16invalid_argument_ZTVSt14basic_ofstreamIcSt11char_traitsIcEE_ZNSt15basic_streambufIcSt11char_traitsIcEE9showmanycEv_Znaj_ZSt18_Rb_tree_incrementPKSt18_Rb_tree_node_base_ZNSt15basic_streambufIcSt11char_traitsIcEE4syncEv_ZNSolsEi_ZNSt9exceptionD2Ev__cxa_pure_virtual_ZNSt13runtime_errorC1ERKSs_ZNSt9basic_iosIcSt11char_traitsIcEE5clearESt12_Ios_Iostate_ZNSt13basic_filebufIcSt11char_traitsIcEE5closeEv_ZTISt12out_of_range_ZNSt11logic_errorC1ERKSs_ZTTSt14basic_ifstreamIcSt11char_traitsIcEE_ZNSt15_List_node_base6unhookEv_ZSt21__copy_streambufs_eofIcSt11char_traitsIcEEiPSt15basic_streambufIT_T0_ES6_Rb_ZTVSt15basic_streambufIcSt11char_traitsIcEE_ZSt29_Rb_tree_insert_and_rebalancebPSt18_Rb_tree_node_baseS0_RS__ZSt16__ostream_insertIcSt11char_traitsIcEERSt13basic_ostreamIT_T0_ES6_PKS3_i_ZNSsC1EPKcjRKSaIcE_ZTISt12length_error_ZSt4cerr_ZNKSs7compareEPKc_ZTSSt15underflow_error_ZTSSt11range_error_ZNSt13basic_filebufIcSt11char_traitsIcEED1Ev__cxa_begin_catch_ZStlsISt11char_traitsIcEERSt13basic_ostreamIcT_ES5_PKc_ZTISt11range_error_ZNSsC1EPKcRKSaIcE__cxa_guard_acquire_ZTISt16invalid_argument_ZNSo9_M_insertImEERSoT__ZSt17__throw_bad_allocv_ZNSi3getEv_ZNSt8ios_base4InitC1Ev_ZTISt14basic_ifstreamIcSt11char_traitsIcEE_ZSt7getlineIcSt11char_traitsIcESaIcEERSt13basic_istreamIT_T0_ES7_RSbIS4_S5_T1_ES4__ZNSt6localeC1Ev_ZNSt9basic_iosIcSt11char_traitsIcEED2Ev_ZTTSt14basic_ofstreamIcSt11char_traitsIcEE_ZNSt15basic_streambufIcSt11char_traitsIcEE7seekposESt4fposI11__mbstate_tESt13_Ios_Openmode_ZNSs4_Rep20_S_empty_rep_storageE_ZNSs7replaceEjjPKcj_ZNSt15basic_streambufIcSt11char_traitsIcEE7seekoffExSt12_Ios_SeekdirSt13_Ios_Openmode_ZNKSt11logic_error4whatEv_ZNSt13runtime_errorC2ERKSs_ZNSt13runtime_errorD1Ev_ZNSiD0Ev_ZTSSt12out_of_range_ZTVSt11logic_error_ZNSt15basic_streambufIcSt11char_traitsIcEED2Ev_ZNSt16invalid_argumentD0Ev_ZNSs7_M_leakEv__cxa_throw_ZNSs6appendEjc_ZTSSt12length_error_ZNSsD1Ev_ZTVSt13basic_filebufIcSt11char_traitsIcEE_ZNSt13runtime_errorD2Ev_ZNKSs13find_first_ofEPKcjj_ZNSiD1Ev_ZTISt12domain_error_ZNSo9_M_insertIlEERSoT__ZTISt9bad_alloc_ZNSt16invalid_argumentD1Ev_ZStlsIcSt11char_traitsIcESaIcEERSt13basic_ostreamIT_T0_ES7_RKSbIS4_S5_T1_E_ZNSt15basic_streambufIcSt11char_traitsIcEE9pbackfailEi_ZTIi_ZNSt6localeC1ERKS__ZNSsC1ERKSsjj_ZNSt15basic_streambufIcSt11char_traitsIcEE6xsputnEPKci_ZdlPv_ZNSt9basic_iosIcSt11char_traitsIcEE4initEPSt15basic_streambufIcS1_E_ZNSsaSEc_ZNSt14basic_ifstreamIcSt11char_traitsIcEED0Ev_ZSt28_Rb_tree_rebalance_for_erasePSt18_Rb_tree_node_baseRS__ZNSo5flushEv_ZTVSt9basic_iosIcSt11char_traitsIcEE_ZNKSs17find_first_not_ofEPKcjj_ZTISt13bad_exception__cxa_end_catch_ZNKSt5ctypeIcE13_M_widen_initEv_ZNSt8ios_baseC2Ev_ZNSs6appendEPKcj_ZTVN10__cxxabiv121__vmi_class_type_infoE_ZTIPKc_ZNSt8ios_base4InitD1Ev_ZNSt8bad_castD2Ev_ZNSt6localeD1Ev_ZNSt14basic_ifstreamIcSt11char_traitsIcEED1Ev_ZTVSt13runtime_error_ZNKSs7compareERKSs_ZNSt15_List_node_base8transferEPS_S0__ZNSt15basic_streambufIcSt11char_traitsIcEE6setbufEPci_ZNSt14basic_ofstreamIcSt11char_traitsIcEED1Ev_ZSt9terminatev_ZSt9use_facetISt7collateIcEERKT_RKSt6locale_ZNSirsERi__cxa_guard_release_ZTVSi_ZNSt16invalid_argumentC1ERKSs_ZNSt11logic_errorD1Ev_ZNSs4_Rep10_M_destroyERKSaIcE_ZNSt15basic_streambufIcSt11char_traitsIcEE5uflowEv_ZSt9use_facetISt8numpunctIcEERKT_RKSt6locale__gxx_personality_v0__cxa_call_unexpected_ZNSs5beginEv_ZSt18_Rb_tree_incrementPSt18_Rb_tree_node_base_ZNSt9basic_iosIcSt11char_traitsIcEE8setstateESt12_Ios_Iostate_ZTVN10__cxxabiv117__class_type_infoE_ZNSs6assignEPKcj_ZdaPv_ZSt9use_facetISt5ctypeIcEERKT_RKSt6locale_ZNSs6appendERKSs_ZTISi_ZNSt11logic_errorD2Ev_ZNSs5eraseEN9__gnu_cxx17__normal_iteratorIPcSsEES2__ZNSt12__basic_fileIcED1Evlibm.so.6libgcc_s.so.1_Unwind_Resume__udivdi3libc.so.6_IO_stdin_usedstrcpy__printf_chkpathconftowlower__longjmp_chkperrorstatvfs64closedirsignalfork__stack_chk_failpthread_mutex_lockselectmkdirtowuppertolowergetpidkillmkstempsymlinkstrlen__cxa_atexitsigemptysetmemsetisalnum__errno_locationchdiropen64readmemcmptoupperpthread_mutex_unlock__sigsetjmpsigaltstackmemcpy__vsnprintf_chkmallocremove__lxstat64opendir__xstat64getenvsscanfalarm__snprintf_chkreadlinkexecvpgetcwdsigactionrenamecloseopenstrerror_rutimereaddir64readdir64_rmemmoveaccessstrerror__libc_start_mainwritesysconffree_edata__bss_start_endGCC_3.0GLIBC_2.0GLIBCXX_3.4.11CXXABI_1.3GLIBCXX_3.4.9GLIBCXX_3.4GLIBC_2.4GLIBC_2.3.4GLIBC_2.2GLIBC_2.11GLIBC_2.1.3GLIBC_2.1       0P&y Oii WaPa aӯkp){t)ii ti ii si ii ii W/ 5 5 6 6 $6 @6 6  7 87 `7 7 7 7 p8 8 8 8 8 8 9  9 09 @9 9 9 :  : H: 0 0 0  0 0 0 0 0  0  $0  (0  ,0  00  40 80 <0 @0 D0 H0 L0 P0 T0 X0 \0 `0 d0 h0 l0 p0 t0 x0 |0 0 0 0  0 0 0 !0 "0 #0 $0 %0 0 &0 '0 (0 0 )0 *0 +0 ,0 -0 0 .0 /0 00 10 20 30 0 40 50 60 71 81 91  1 :1 ;1 <1 =1 > 1 ?$1 @(1 A,1 B01 C41 D81 E<1 @1 FD1 GH1 L1 HP1 IT1 JX1 K\1 L`1 Md1 Nh1 Ol1 Pp1 Qt1 Rx1 S|1 T1 1 U1 V1 W1 1 X1 Y1 Z1 [1 \1 ]1 ^1 _1 1 1 1 `1 a1 b1 c1 d1 e1 f1 g1 h1 1 i1 j1 k1 l1 m1 n2 o2 2 p 2 q2 r2 s2 t2 u 2 v$2 w(2 x,2 y02 z42 {82 |<2 }@2 ~D2 H2 L2 P2 T2 X2 \2 `2 d2 h2 l2 p2 t2 x2 |2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3  3 3 3 3 3 US[øqt) 脣X[5/ %/ %0 h%0 h%0 h% 0 h%0 h %0 h(%0 h0%0 h8p% 0 h@`%$0 hHP%(0 hP@%,0 hX0%00 h` %40 hh%80 hp%<0 hx%@0 h%D0 h%H0 h%L0 h%P0 h%T0 h%X0 h%\0 hp%`0 h`%d0 hP%h0 h@%l0 h0%p0 h %t0 h%x0 h%|0 h%0 h%0 h%0 h%0 h%0 h %0 h(%0 h0%0 h8p%0 h@`%0 hHP%0 hP@%0 hX0%0 h` %0 hh%0 hp%0 hx%0 h%0 h%0 h%0 h%0 h%0 h%0 h%0 hp%0 h`%0 hP%0 h@%0 h0%0 h %0 h%0 h%0 h%1 h%1 h%1 h% 1 h%1 h %1 h(%1 h0%1 h8p% 1 h@`%$1 hHP%(1 hP@%,1 hX0%01 h` %41 hh%81 hp%<1 hx%@1 h%D1 h%H1 h%L1 h%P1 h%T1 h%X1 h%\1 hp%`1 h`%d1 hP%h1 h@%l1 h0%p1 h %t1 h%x1 h%|1 h%1 h%1 h%1 h%1 h%1 h %1 h(%1 h0%1 h8p%1 h@`%1 hHP%1 hP@%1 hX0%1 h` %1 hh%1 hp%1 hx%1 h%1 h%1 h%1 h%1 h%1 h%1 h%1 hp%1 h`%1 hP%1 h@%1 h0%1 h %1 h%1 h%1 h%2 h%2 h%2 h% 2 h%2 h %2 h(%2 h0%2 h8p% 2 h@`%$2 hHP%(2 hP@%,2 hX0%02 h` %42 hh%82 hp%<2 hx%@2 h%D2 h%H2 h%L2 h%P2 h%T2 h%X2 h%\2 hp%`2 h`%d2 hP%h2 h@%l2 h0%p2 h %t2 h%x2 h%|2 h%2 h%2 h%2 h%2 h%2 h %2 h(%2 h0%2 h8p%2 h@`%2 hHP%2 hP@%2 hX0%2 h` %2 hh%2 hp%2 hx%2 h%2 h%2 h%2 h%2 h%2 h%2 h%2 hp%2 h`%2 hP%2 h@%2 h0%2 h %2 h%2 h%2 h%3 h%3 h%3 h% 3 h%3 h %3 h(%3 h0%3 h8p1^PTRhpa ha QVh oUS=T: u?X: . . 9sX: . X: 9rT: []Ít&'U. tt $. ÐUSh; t&$: u[]Í&U`: {d: qh: gl: ͇$t: p: D$$3 D$t: $ Í&'US< $t&C$%$; u$[]ÉE$E$VUWVS uPDXdTU쉍DDžH@Dž\Dž`hlƅDžDžDžDž@@@@@@@ @@49uED$t$$dB$\43u4vFt$a4;4t6^(t߉CuӋ$PCu$P 뵐t&tHt,s tFt(t$$3 [^_]Ë4$PFu4$P 뷋ƅt$4$-VÅt$|tH$l5$Ɖ$>볉ǃhuԃ4F$$9utH$5<$UWVSuD$k ]4$莦EdD$$E$D$觤UD$$$4$|U Dž| : 4$D$gE䍝xD$$|$D$@}D$<$$y4$qtD$k $˥p|$$Yt$D$u܉D$4$8$ t$4$4$<$E$u e[^_]ÐU؉$D$k =E U؉T$D$Eԉ$uЍUD$k T$4$GUE0,`\vCt ߉ÍCt$$yC u9`CD$4$n4$Eԉ$ E؉$9`}D$k u<$NE |$4$D$+]D$k t$$a\$U$\$4$<$}uD$k d<$D$U T$|$4$豱]D$k t$$$d$4$<$dE$}D$k [U ED$<$T$5uD$k |$4$kU0u*C\tÍCt$$:yދC u䋝\9`CD$4$4$N<$FE$;9`}D$k u<$艢U |$4$T$f]D$k t$$蜢\$E($EU$T$v$4$<$}D$k u<$E |$4$D$]D$k t$$\$U$Z$Q4$I<$Ae[^_]Ð}D$k uȉ<$蒡U |$4$T$o]D$k t$$襡\$E($NU$T$$4$<$f`t&`?M$XX4$XlX<$XXX$밍뼍ȉ4$X X<$X XU$v']t&'at&'e$XXt$XX<$XXU$ݍv'$X`X4$XLXf$X0X4$&}t&'t&'qt&'M4$XX%4$XXUԉ$XXU؉$)]t&Ѝ&'UWVS}=x: u$x: *UE0,P*Ƌ} T Ct މÍC|$$yC uT9P\$] $y $E $D$DExt 'DžDž$lj$ߩ$X!@ @@@ @@@@@$x,h; C0l; C4t@CL{LCPCTC8C<C@CDDž@D$D$<$CPST9y41҅t ƒSPDž$-X @@`q \$\$ $z]CHs(t$C8\$D$C0D$ C,4$D$u,CLCH`( C)i9$$k $E<$D$M $D$!uD$4$r$Zt$$4$@E D$E($蔹U T$$OSHCL<'DžDžtC#3]}EDžDž(L1ۉH!D$(D$dc $7 EPD$$7 T$rË@t|1~F'D$$$D$ D$k $7 <\$$7 D$CD$c $@t|0~F'D$$m$u$w,U$|$~ɉT=t9T5TB0;C0TUDž| : D$ T$A@D$A<$yE$+EH]E : A@+A<<E0nPvFt#ƍUFT$$諲yߋF u9P}Mt$ $耲cUED$$Fkp| $E p<$D$5D$k <$‰։<$NU l $T$lD$4$$E4$D$赋hD$<$4$U0PTt&Ft(TƍF|$$ZyދF Tu9PFD$<$.<$nl$`9PU d $T$dD$4$4E4$D$Ŋ`D$<$4$H|$$YM $L$<$d$U \ $T$o\D$4$E4$D$5XD$<$4$kU|$$D<$T\$F $|$*E$҉T=: u$: HDžDžD$ D$h D$g $1$8lj$$X`@ Dž@@@ @@@@@$x,C0C4t@C8CLC<C@CDCLCPCTT$D$$Dž$X @@`q \$\$$JCHs(t$C8\$D$C0D$ C,4$D$CLCH C)i9k vD$*D$`d $@6 EPD$$@6 T$D$D$k $@||$tUG'D$4$>$F+PHED$$M $L$t<$D$ <$P땋A,;F,A8;F8AH;FH $D$nI8D$4$\I;8l(T{vPPSHCL<DžDž$`HtCtF_tCnt&t9fC0;F0DžP : C@P+C<{< $D$s<;s@t*t&PD$$D$;wuۋP5: BN95: 9F5: 9F5: 9F<5: 9F]5: 9F}5: 9F5: 9F5: 9F5: 9F5: 9F5: 9F=5: 9F]5: 9F}5: 9F5: 9F5; 9F5; 9F5; 9F5 ; 9F=5; 9F]5; 9F}5; 9F5; 9F5 ; 9F5$; 9F5(; 9F 5,; 9F= 50; 9F] 54; 9F} 58; 9F 5<; 9F 5@; 9F 5D; 9F 5H; 9F 5L; 9F= 5P; 9F] 5T; 9F} 5X; 9F 5\; 9F PD$$`; ZkDžT`; u4PT$$d; 6kDžTd; uDžTh; P $Th; l $|=: u$: DžDžDžDžDžDžƅDžDžDž$P舏Í$P\D$D$D$ : PT$\$$, =: u$: U \DžhDžlDžpDžDž\Dž`PDždƅtDžxDž|$:   =: u$: =] \P$: tO\DDžD : T`+T/ E U\$D$$.$f|tCb \t$$+Bt$tC tC tCm tC, $e[^_]Í&9ɉDžT: 85: 9F v9DžT: 8x5: 9F9DžT: 8H5: 9F9DžT: 85: 9F9DžT: 85: 9F9DžT: 85: 9Fc9DžT: 85: 9FC9DžT: 8[5: 9F#9DžT: 8,5: 9F9DžT: 85: 9F9DžT: 85: 9F9DžT: 85: 9F9DžT: 8p5: 9F9DžT: 8A5: 9Fc9DžT: 85: 9FC9DžT: 85; 9F#9DžT; 85; 9F9DžT; 85; 9F9DžT; 8V5 ; 9F9DžT ; 8'5; 9F9DžT; 85; 9F9DžT; 85; 9Fc9DžT; 85; 9FC9DžT; 8k5 ; 9F#9DžT ; 8<5$; 9F9DžT$; 8 5(; 9F9DžT(; 85,; 9F9DžT,; 850; 9F9DžT0; 854; 9F9DžT4; 8Q58; 9Fc9DžT8; 8"5<; 9FC9DžT<; 85@; 9F#9DžT@; 85D; 9F9DžTD; 85H; 9F9DžTH; 8f5L; 9F9DžTL; 875P; 9F9DžTP; 85T; 9F9DžTT; 85X; 9Fc9DžTX; 85\; 9FC9׉DžT\; 8#vD$<D$h $@6 w<)Dž : G@+G<$D$7_<9_@t,&D$D$$;^uۋPD$$@6 T$É $D$ D$qn $U PD$$T$vË@t|5~t}F'D$$$C,;F,GC8;F8;CH;FH/D$$y98D$4$g9;8t&4$D$ 4$PjT$TDž : G+B$4$D$TY$9_tD$4$D$s;_u፝Dt$$4$1SCDD$%DΉD4$D븍UD$DD$ݱDΉD4$DZDuD$謱D\D<$蓱DQ\D $tDD4$[DˉD<$ED뵍D$)Dt&vSLƅt$貮S4$D$$$葮D$讷$VD$$DVD藶D@))ڍ: : t$Y$: D#D뺍벍몍뢍뚍뒍늍낍wvot&'_t&'Ot&'?t&'/t&'t&'t&'t&'t&'t&'t&'t&'t&'t&'t&'t&'ot&'_t&'Ot&'?t&'/t&'t&'t&'t&'t&'t&'t&'t&'t&'t&'D$: !$: ʹDD$: !$: 褴DID$: !$: {D:D$l; ~!$x: RD$ĴD4$QDDH4$2D\Åt$Ӫ&Jt&'D$ݬD|wD&7t&'LTD$$!pD$$!;pZT&TD$$ xD$4$ ;x9T$D$ XD$4$ ;Xtt&UWVS|Eu xuxtZEUX($ׅu %C߅tÍCt$$NyC u9ts|$4$,x`EUX@<ׅu+C߅tÍCt$$yC u9t|$4$̂xe[^_]ËU$t$8T$dDUt$$dUt$$b=p; u$p; E]t$$D$]\$$w$p$j$i$X @ Dž@@@ @@@@@$P,; C0; C4t@C8CLC<C@CDCLCPCTT$D$$趲Dž$JX @@`q \$\$$CH{(|$C8\$D$C0D$ C,<$D$YCLCH C)i9tlk CE؉\$$Trx(EU؉T$$E؉$胚U؉T$$kt$$뵐t&C,;B,C8;B8CH;BHwD$$$D$x;$t&ED$t$$AnSHCLΉlj4$t&+ǐt&뿉Ǎt&‰Ǎt&ʼnlj4$<$\ǀ}cEԉ$SDŽtލEЉ$͌щǍE$辌ZUlj$謌HҍU؉E$脌Eǀ}Ủ$eljtލEȉ$MѐUEw ]ÐUEPr ]ÐUEt BvÐUE]utCt ]u]Ë$Psu]u]@ ]U]ÐU]ÐUSEM P)iҫ9}x I[]f[]ÐU1]ÐUVSE ] ɉL$$Єt: s s t̍ɋ2DL$$ЄuƋC,[^]ÐUVSE ] ɉL$$Єt: y y t̍ɋ2DL$$ЄuƋS,[^]ÐU(E]U u]}t0 Iqf ~t]u}]Ðt&uat* IIDq t t t vuvt t t t tvu.1f_t&st&t넍D$ t$$ tD$t$$'UMWE VSy9B BBB)iv$$rD 9s3r[^_]ÐUE@,1]ÐUE @,1]ÐUU$] t$ ދAB,ABA u1 $t$]ÐUE US u YZ,YZ []ÐUUS HtX  []ÐUWVSU} sB1 Kue)C BB4R8Bt*8D> tC KFB,1[^_]Í& D u[^_]Ívz;zuBEf [^_]ÐUWVSE} S ;PsKPt$}@4P8;MPr<;PuF@1 tP;Pu;Pt @E& u$ct&;Pt:D> t9Mt4PKS VP,1[^_]Ív [^_]fP D uUE US uYZYZ,ZHC  []ÐUE} u  ]ÐUMWE VSy9B BBB)iv$$rD 9s3r[^_]ÐUE@,1]ÐUE @,1]ÐUU$] t$ ދAB,ABA u1 $t$]ÐUE US u YZ,YZ []ÐUUS HtX  []ÐUWVSU} sB1 Kue)C BB4R8Bt*8D> tC KFB,1[^_]Í& D u[^_]Ívz;zuBEf [^_]ÐUWVSE} S ;PsKPt$}@4P8;MPr<;PuF@1 tP;Pu;Pt @E& u$ct&;Pt:D> t9Mt4PKS VP,1[^_]Ív [^_]fP D uUE US uYZYZ,ZHC  []ÐUE} u  ]ÐUEP;P tb@2u<;PtJ u6: t)P,RP,]R t t tݐt&1]Ít& t&tƀ t1琍t&H0ut1АU E$t$|$P;PtdX0u>: Ή u;P tPz t0fP,RP,u݉ t1$t$|$]Étf@0tfۍt&t랐UEP;Pt t" t ftu"x0y1]Í&H,IHdu1P,R@P,]ÐUVS]C;CtmS`T$D$C($4ƋC;C tXPSS`T$@D$C($ C1Ɖ1tC,@C,[^]Í&s0;C uS0utf뺐UVS]C;CtMS`T$D$C($ƋC;C tRPSS`T$@D$C($ZC8t1[^]Í&C,@C,[^]ÍvC1tUS]C;CtnS`T$D$C($tQC;C t9S`T$@D$C($u+C,@C,[]Í&S0ut؍v1[]ÐUS]C;C t^S`T$@D$C($dtHC;CtHS`T$D$C($?u#C,@C,[]Í&C1uf1[]C0 t𐐐UEP;P t 1]Í@0uP,RP,]ÐUEP;Pt 1]Í@0uP,RP,]ÐUEP,RP,]ÐU1UJ;Jt]ÍB,@B,]ÐU1 U|$$t$J,rY+z 9)މrAB,$t$|$]ÐUEP,JHDRP,]ÐUEP;P tb@2u<;PtJ u6: t)P,RP,]R t t tݐt&1]Ít& t&tƀ t1琍t&H0ut1АU E$t$|$P;PtdX0u>: Ή u;P tPz t0fP,RP,u݉ t1$t$|$]Étf@0tfۍt&t랐UEP;Pt t" t ftu"x0y1]Í&H,IHdu1P,R@P,]ÐUVS]C;CtmS`T$D$C($ƋC;C tXPSS`T$@D$C($C1Ɖ1tC,@C,[^]Í&s0;C uS0utf뺐UVS]C;CtMS`T$D$C($dƋC;C tRPSS`T$@D$C($:C8t1[^]Í&C,@C,[^]ÍvC1tUS]C;CtnS`T$D$C($tQC;C t9S`T$@D$C($u+C,@C,[]Í&S0ut؍v1[]ÐUS]C;C t^S`T$@D$C($DtHC;CtHS`T$D$C($u#C,@C,[]Í&C1uf1[]C0 t𐐐UEP;P t 1]Í@0uP,RP,]ÐUEP;Pt 1]Í@0uP,RP,]ÐUEP,RP,]ÐU1UJ;Jt]ÍB,@B,]ÐU1 U|$$t$J,rY+z 9)މrAB,$t$|$]ÐUEP,JHDRP,]ÐUEPr ]ÐUEPr ]ÐUEPr ]ÐU1]ÐU1]ÐU1]ÐUS$]C${w]$[]nw$EcwE$~US$]C$;w]$[].w$E#wE$x~US$] q C$v]$[]Hv$EU:vUEt$'~$xUS$] q C$v]$[]u$EUuUEt$}$_xUS$] q C$5v$u]$[]s$EUruUEt$_}$wUEPr sUEPr {sUEPr [sU]]ut5C$ruC$gu$_uu]]]s]u]ÉƉ$4u4$|ƍC$uᐐUEw rUEPr rUWVS<}9} E Wp)iMEEԋ)iҫ9UW)Miɫ9MM؍ MiMث~G1҉M䍴&44tttL muދ] Ws)ىMM]M9u܍[ t@]܉} & t3{2szJ 9uߋ}] [O<[^_]Ít&u1ҍ u~44tttL mu밍t&EEEt}UUUwaMM؉ $!vE9t)Et& tKSHP 9ut$p]܋M؉ىO8 yUWVS<}9} E Wp)iMEEԋ)iҫ9UW)Miɫ9MM؍ MiMث~G1҉M䍴&44tttL muދ] Ws)ىMM]M9u܍[ t@]܉} & t3{2szJ 9uߋ}] [O<[^_]Ít&u1ҍ u~44tttL mu밍t&EEEt}UUUwaMM؉ $1tE9t)Et& tKSHP 9ut$n]܋M؉ىO8wUVS0EM $uPÅt;H~P u9t;K}X $t&UuT$D$4$Er]t$$o4$^p$V$Nu0[^]Í&u\$4$>o뷍t& $ UuT$D$4$q듉$`wE4$oE$JwE$tE$4wʐU]]u tO t ǀJr ]u]Ðt&D$C($e]u]ÐUVS]C;CK,tzT tLt0 q 9 wdtSpPK, AC,[^]Í1tAC,[^]Ë 농$ 뉐U]]u tO 9t ǀJr ]u]Ðt&D$C($]u]ÐUVS]C;CK,tzT tLt0 q 9 wdtSpPK, AC,[^]Í1tAC,[^]Ë 농$ 뉐US$]E $D$'lED$C$l$[]ÉE$lE$ItUSE Z R $ []ÐUSE Z R $[]ÐU8]]}} uE : 9tGt[)߉D$D$<$erp t3U|$\$4$hmUB:>]u}]ÐB ۅt $Hb pD$1D$$qp 딐US] Ut7|/ut#|/tvx/t v1[]Í&D$D$/$i9ӐU8Muu ]}tw$mÃEt'ED$E$iED$C$iFD$ E\$<$D$KnEF]u}]vF9EtE1D$E$!Bg]Ɖ4$Jq$hhƋE$@j܉Gp4$qU(]]uu }t_$lÃtU$T$hFD$ E\$<$D$fmUFЋ]u}]t&F9EtE1D$E$9Ayy$t&cp$+ggoo4$pUWVSU܅yC t@|$T$ T$Et$$Et&|$FD$ D$̉|$\$ D$ |$D$ D$&|$T$ 빉|$D$ D$zUWVSx߉ދ[ 1utU ;Z tt$eƍF|$$=xE0@e[^_]Ã|$E\$ D$U T$$UEBЃe[^_]E|$\$ D$ĐU4$|$E0E N81;Ot4$|$]Ít&94$|$]ÐUS$]t2SET$S T$$)$.e]]bf]É$EeE$elUWVS,u E : }F+<$D$m;^t!fD$<$D$e;^uEPD$ET$$lÉ<$d,[^_]ÉÉ<$zd$kUVSuF0uA^V9tL~DN(tR $D$QV< t< t< t9Ӎt&t1[^]Ðt&9uF,@F,[^]ÐUWVS,]{,GEt\C1;Ct+t&{DS(tR D$$Q8D7 t 1,[^_]ËC9uCv 9Cu1ދ{,GC,,[^_]ÐUWVS,]{,GEt\C1;Ct+t&{DS(tR D$$Q8D7 t 1,[^_]ËC9uCv 9Cu1ދ{,GC,,[^_]ÐUVSuF0uA^V9tL~DN(tR $D$QV< t< t< t9Ӎt&t1[^]Ðt&9uF,@F,[^]ÐUWVS,]} Ep‹xFC,FEB SC9tS{DS(tR D$$QU|CC4S8;PSNK,rEu\t&9S9EUxCB FC,1,[^_]Ít&;St@D Tt;sSS똃 ,[^_]f ,[^_]Ít&C D tr C1 tC;Cu ;StCEf 7UWVS,]} Ex‹pGC,@ EB SC9tK{DS(tR D$$Q8ECC4S8;PSOK,rDu[v9S9EUpCB GC,1,[^_]Ít&;St@D ]t;sSS똃 ,[^_]f ,[^_]Ít&C D tr C1 tC;Cu ;StCEf 7UWVS,]} Ep‹xFC,FEB SC9tS{DS(tR D$$QU|CC4S8;PSNK,rEu\t&;S9EUxCB FC,1,[^_]Ít&;St@D Tt;sSS똃 ,[^_]f ,[^_]Ít&C D tr C1 tC;Cu ;StCEf 7UWVS,]} Ex‹pGC,@ EB SC9tK{DS(tR D$$Q8ECC4S8;PSOK,rDu[v9S9EUpCB GC,1,[^_]Ít&;St@D ]t;sSS똃 ,[^_]f ,[^_]Ít&C D tr C1 tC;Cu ;StCEf 7UWVS,]SK,:Bq)i9}xv4 t&rR9UC;Ct{DC(u:8t,1[^_]Í&C9uCtP9Ctـ{DC(tƋҋ@T$$QK({Dt I9D$ $UWU늋K,AC,,[^_]ÐU]]uC;Ct9{Ds,S(u:|t C,@CC,]u]Ít&]1u]Ít&R D$$Q|uU]]uC;Ct9{Ds,S(u:|t C,@CC,]u]Ít&]1u]Ít&R D$$Q|uU1S]S;St2{DK(u0B;CCt {DBS(u8C,@C,[]Ít&R $D$QS뷍&R D$$Q벐U1S]S;St2{DK(u0B;CCt {DBS(u8C,@C,[]Ít&R $D$QS뷍&R D$$Q벐UWVS E} N^QP,V ;PPts]   ux0t&P,RE@4P8P,PZ]Xy9]]x,reU9P]uw@1 tP;Pu ;Pt@Ef uZ x,Xdj  [^_]Ë]9XtRD9 ];]tP^V QP, 1[^_]Ðt&] D uvUWVSE} UrZuuKV ;PH,Ptj]   Ґu x0Q]E@4P8P,PrpK9]H,]rB9p]uTU@1 tP;Pu;Pt @E& u5`9ptcR]D; HU9UtNMUq QSP,1[^_]fqXd.U [^_]Ë]VU D unU1(uu]}V,Z't:~Z'rN9A)i9}(x$[R AV,]u}]Í&RAV,ݐс'T 1u(RV,뼋F$\$$RV,st&k4R9L>4V, 냍&F$L$$RV,딐UWVSL} E9}EmMU]AR Utu}ԉE&E}{uEv9t 8t&;uMEE9AwU}UEx sME : A zEЍMD$ D$: D$D$Mԉ $XE1H f;uUBt!\$Mԉ $U;u{s+UB UzUEԉ$SEe[^_]Ít&M}tȋR$L$P8ti;tvut& 9u@L$$R8t_ExUEe[^_]ËpUE : UUЍEfEu؈UUD$ T$Mȋ4$D$ =t$Eԉ$9W4$RU1ztet&;UBExU;ust&>uM^9y E@FUԉ$RM]ЋA\$D$Eȉ$ MAEx]+MȋMЋPL$$PE?fu :ft$Eԉ$ASAt&t&u:vf\$Mԉ $ S;uU9r:H+vUzl;uu[D$\$Eȉ$UzU0UЍEfEu܈UUD$ T$Mȋ4$D$EERUt$Uԉ$/U4$wP`E4$Ít&[PMԉ $PP$W݉Ít&㐐US$]CS9tDKDL$K$ L$ K,T$$L$;CtS,RCS,$[]Ít&$1[]UWVS<]} EPxq BsEC,C9tTKDL$K$ L$ MD$4$L$ULU9KC4S8;qsBC,r?uN9s9t}EMxCA BC,1<[^_]ÍC9tID W;sss뢃 <[^_]f <[^_]Ít&C D zx C1 tC;Cu ;stCEf =UWVS<} u4V, 냍&F$L$$RV,딐UWVSLEXxMv:/1؀:/u fuؾ9BtaK9K|/t"u :/f</u9|t&z/n1gM 1ۋ:/%%Mlj $?t$?<$HG搐U8uu }}]BtAuB\$D$/4$@XJu1f:/tK|/Xut</tnB9ÐD$ \$t$<$>]u}]z/i1Ðt&1f1ۀ:/sq\$4$Lu@{ED$ D$.D$<$>4$6>]u}]lj4$><$sElj$ >4$><$YE쐐UWVS|U@u Ee[^_]ÍME : uT$ $}E : U}̋@EЍEȉD$$FV<[^_]ÍvЋ;+E K[i}9ƉEv)9E܉Ut;uЉމM tXH_O 9uEuЋMԋ@Eԋ}EE܉G+} i~.1M䐍t&LLLLLL uߋME E;E "U u؍&2JZ 9u<[^_]ÐU EE)i$68E܉t&+}܉Uԅt(}ԋ} tH8XuE}ԋ@EԋuԍFV<[^_]ÍvЋ{+E [i}9ƉEv)9E܉Ut;uЉމM tXH_O 9uEuЋMԋ@Eԋ}EE܉G+} i~.1M䐍t&LLLLLL uߋME E;E "U u؍& rZ 9u<[^_]ÐU EE)i$&4E܉t&+}܉Uԅt(}ԋ} txXuE}ԋ@EԋuԍN)#;difs k4<WlDpS,4$D$蠷G|F Ek449 xl@h0kU4F~1FDt+DpFF iЫEtUUUE$.NjU~ ~FkE4Ht@p9щEtRu܉}؉]Đt2z0rxX 9uߋE}؋u܋]ă )iɫ*?DIuE^EU9P rMQgE$Q(U]B\$<$D$MyuE E Ue[^_] @L$$R 8LUU;9uȋM;A.19;t&v1Ҁ}tȋR$L$P8t"f;tMAt&Exu5E;E t'ED$D$U$,Ee[^_]E E ыBME : MEUfEuԈEED$ T$4$D$9t$U$g+4$&M1AC&;u{U܋BudUzE MM $i&E?;usMPL$$PEE E du:tv\$E$'x;uE9pI::Af#UB3Mȍe[^_]MAuwUztE E M_E MEUfEu؈MD$ T$4$D$E܉EvUQt$U$)4$+%D$\$<$qEx4$$U$$$>,琐US4]C;CtVKDUL$K$ L$K,L$ KD$$L$0E9CtS,RCS,]Í&1]ÐUWVS<]} Ex‹pGEC,B SC9t_CDD$C$D$UT$ CD$CD$E$C;EC4S8PSO;K,r<uS;S9~U܋CrB GC,1e[^_]f;St@D Qt&몍;sSS띃 e[^_]f e[^_]Ít&C D vt C1 tC;Cu ;StCEf 9U(uu} ]} u>k 4SThSk 4<WlDpS T$$豭C G|C,{4$fC t$ ]u}]ËS ƅt$4$)US$Et(C $t$]$[]f$[]Ët$EE$&)UVS] ; t C,t&x x C4S8$ЄC8;C@S4rw;SUWVS<]s,Fx tC1uE&{Gu狎ESCU)9v M1;Ut1{DK(tR $D$QS8tQS+M䋾19w5}uO9FC,C;CD t&<[^_]Ã;USwM+M렐t 9vS9t- {9 wMtHpx FC,<[^_]D$ T$ t$L$$DD$M褚 M؃뚋 >UWVSL]{,O S1;SK,t#}U< tSt&< tK< tGu{0y1L[^_]Ít&AUC,E9ECv 9CK,t< uySdt묍t&׀ C0E;s?S;SK,Ut1EUԃEE}< ty< tu< tqu|}tu}䀿t9vCC9t1 S9 tpxP GC,L[^_]ySdttAUC,Eԃ9EԉCvo9CK,EZ{Gt&f9fw#GC,C;Ct`D L[^_]D$C|$t$$D$ 뼉$Uh U܃1r UH]]u}C0s,KdVJu_E}KC)9v9}wu}C~9FC,C;CD >t{GtEE뎉]]u}]t&K1]u}]Ít9wg9t* 9 wVtzrB FC,D$ D$ t$|$$|&C딍v$Ef˖ E܃돐t& =UTUX]]u}C,PH ҈KDC2uCLR{0P$|D uC,@C,]u}]Ðk44 9Vhu։ Fl{C,D p<$D$F|G Ek449 xlPhC VkU4~1FEDt+DpFF iЫtUUUsE$NjU~ ~FkE4Ht@p9щEtUu܉}؉]čt&t2z0rxX 9uߋE}؋u܋]ă )iɫ*?DI ~ 9 v$\ tSx P FC,L[^_]Í& U܉ aMU܉EEt( EEǀEԉHMHEċMԉ ^&v ЃEPD$C($U} U똍$@ UWVS<]C;Cs,}T MU狋 9>9 tDACHACHy AACHA;xt @;xuP @QACSH z t 9BRBSHB 9C1t{Gtt9}~}t8 ~ 9 tSxPSH B B FC,<[^_]Í&}uJ9vf}uʃ<1[^_]Ë;y SH;zAC9vD}t> ~ 9 v$} tSx P FC,<[^_]ÐJ  \Jt" Uԋ ǀQUԉQ C }rv MUt&D$C($z 뙐t&$| 2UH]]u}s{GtaFHtlj]u}]Í<$^ |$$D$=PF@~밐t&$`lj<$CEUԉ|$$D$Cta7tXSztED$D$ $CK }܋D$L$<$R Uԃ|$$<${t&D$fk $FD$E$UT$$WE$\D$hk $l&D$bk $PEt$$1UT$$E$D$hk $f$HTEЉ<$EЉ$$ $vtC$vv빍UEЉ$EUEЉ$mE믃uʼn$[$SUWVSL] S0u~Cfy9Ct1L[^_]Í&@t9CtsC,;AAA AFFFCFtt$$tC0 뗍K1A)#C;difs k4<WlDpS,4$D$uG|F Ek449 xlPh0VkU4~1FEDt+DpFF iЫtUUU`E$NjU~ ~FkE4Ht@p9щEtRu܉}؉]Đt2z0rxX 9uߋE}؋u܋]ă )iɫ*?DIǃ 4$UWVS,]u}E $D${ sC : Xt CC$  : @ : @ : EE$p @@t EEt$t$$)USsEUUCSutFtCU$T$<,[^_]Ít&4$PFuˋ4$P $G4$jlj<$0CE؋CCCE܍E܉$T&눉fǍC$S$Di<$LܐU(]]usXt tFt%C q $]u]]v4$PFuċ4$P 뺉$ƉUhUt%4$$ƉUUu4$54$-ʐD$ &US$]C hw Cw t$RXt C$R q C$$ ]$[]sts$EUEUtN$$EUUEu߉$l$EUgEUu$K뭉$t&;$3냐US$]C hw Cw t$RXt C$Q q C$]$[];ts$EUEUtO$$EUUEu߉$$EUfEUu$s묉$vc$[냐D$ &US$]C hw Cw t$RXt C$ Q q C$]$[]Kts$EUEUtO$%$EUUEu߉$$EUeEUu$묉$vs$k냐D$ &UWVSu$4x8 ÍFD$C$.FV  q CFS D$C$ FXt CFCt@F Cw C t$R F$w Cw C0w C$F(C(F,C,D$D$u $Ɖ׉$t$4$Ɖ׉$Ɖ׉$_D$ &UVSu$48 ÍFD$C$FV  q CFS D$C$FXt CFCt@F Cw C t$R F$w Cw C0w C$F(C(F,C,C0[^]ÉƉ$$&4$Ɖ$tƉ$ؐD$'D$ &US$]C C0w hw Cw t$RXt C$M q C$$)]$[]|tt$EUEUtP$$EUUEu߉$u$EUbEUu$Tf뫉$vC$;u$.rD$'D$ &US$]C C0w hw Cw t$RXt C$L q C$]$[]tt$EUEUtN$$EUUEu߉$]$EUaEUu$<뭉$t&+$#u$rUWVS\]uE8 4$CD$C}ȋS E q <$ECUĉD$CEXt E̋CEt@EEEEEhw E|w $48 Í@t$$nEU q CCS |$$MEXt CEЅCt@E1Cw C t $R u؋Ew Cw C0w C$EC(EC,C t$Rs t4$P EEhw EԐw C$EC(EC,E؅t$REEXt $JE q <$qE$D$D$u $ƍE$4$ƍEU$Ut(4$yƍEU$Y_Uu4$4$ƃuɉ4$؃utJx 4$Ex.vxl9/t&tf|/Pu9f)D$ D$T$$PẺ$D$aEUCS<$4$e[^_]Ðt&y/1똉EċCCEȍEȉ$OD4$Ge[^_]Í&1ҋ@T 9/A1?E؍U܍}EUED$Et$ <$D$B D$T$TUE҉UEt[Uԉ$D$zE}ЉD$D$b <$mE]D$ UEԉD$|$$T$ $aP UJx 4$1U:.zB0@x 4$ Uz.zf$7k OE4$E$IE<$E$<$Uԉ$EEt&吐Uuu]^ tCt+tE]u]$t&]u]Í$PCu$P 봋Åt$$wUuu]^ tCt+tE]u]t&]u]Í$PCu$P 봋Åt$O$U(]]usXt tFt-C q $D$u]]]v4$PFu4$P 벉$ƉUJVUt%4$J$ƉU=Uu4$4$ʐUE]uXtCt]u]Í&$Psu݋]u]@ ]UVS]tyCLt$s4tFt,C $!@t$][^]t&4$PFu4$P 볍&[^]fÉƉ$4$ƅt$m4$UWVSl]o)҉ t ǀK0ǃ C4C8sC S$EEECCUP,S,SuEEt @(EE{ỦUEO7})iuEċE9EvbMI9EĉOM) iɫ*? I t&Ũ U9ȉPUԈPuav9t%E ỦUЉPUԈP 9uu9ut+ẺD$ E+EĉL$<$D${$}{UuMP C A$G vEuKFEظFuFFqE܋U؋{t@w WG tFu܅tFutFC0C0urS$U 1҅tQD$$E.C1uC$@0ńr ŀr $ЉƋ $T&ǃ l[^_]Ë{$s SEu}Et @(EăE3ỦUE~uEE+EiEE9E;}tEỦUЉPUԈP 9uU9UEt-ẺD$ E+E|$4$D$s$K0u3}Ux E@$C F & Df3F)Ѓ#VRUSSu$F)Ѓ#u;sCSEEu#{$EEt @(EECỦUEp8E)i}EċE9E9t#Et&ỦUЉPUԈP 9uU9Ut+E̋MD$ E+Eĉt$ $D$蚎uK0}x E@$bv}č}ljEċE~9w}ĉE)ǃ i*?<< t&Ũ U9PUԈPuE0&muvƉEċE9pMu) i*?4v4Ũ U9PUԈPu4$PFa4$P T4$vPF4$P t&4$vPF4$P t&4$vPFq4$P dt&B;Bf|fa1 ƍE܉$8E$84$D$$9uЉ $"ǃ 4$밉‰E1EUWVS\}] HUE : uEE|$$ME̍U؉D$$;Ủ$u E܉D$ED$E؉D$ UAD$A t$D$$KUEĉUU؉E$U@ Uԉt$$EԍUЉD$|$$EU܋;EEЉUD$<$"UEWUЉG$[Eԉ$PExx 4$E8.UtTUBBt&7G{CtGthEUEB4$Ee[^_]t&sCtFtCE$P;Ee[^_]<$PGu<$P tt&4$vP^u4$P 랐xt&un$vvv{CG<$PG<$P t&4$Ex.xxnmÍUԉ$4$$ÍẺ$unމډÍE؉$[ˉÍEЉ$L뱐UWVSlu$F : @@@ @$@@y X F\$\$4$%5U Et$$T$/]EۉEue[^_]Í&7tE}D$D$b <$=UE \$ ]ĉ|$T$D$$$4$,$ZoE$EE<$EE4$4E$Z㍶͉EvE$8U(uu} ]} u>k 4SThSk 4<WlDpS T$$LC G|{,tGt.C t$4 ]u}]Ít&<$PGu<$P 뱋S ƅt$込4$VUVSEX tvCLt$菼s4tFt)C $2t$`][^]Rf4$PFu4$P 붍&[^]fÉƉ$E4$ƅt$4$UE]ut;s tFt5t$跻]u]]馻]u]Í4$PFu4$P 몋ƅt$_4$UWVS,EEtdƃ4\ E&Ft$4;ut1^(tCu֋$PCu‹$P 븋UBPtRLEXt/C $0t$覺],[^_]闺&,[^_]ËVÅt$wMQPtMALE$w$ƅt$?4$UWVS MUt @v]D@PXUD] ldU쉅DžHThƅDžDžDžf@@@@@@@ @@49uEEL$4$D$M4$ǃ4]t&C($=/Ct$49uߋtHt!C $/t$貸$誸 [^_]Ðt&1 [^_]Ëƅt$y4$ǃh]ԃ4C$9utH$W<$Sƅt$tH$4$É4$$UWVS\}HGt @5$X˼EEƋC+FiЫFtUUUEЉ${EԋEԉFS EЉU9M̉ʉFEԉMuȋủ]ąt ZJXH 9uEЋŰMԋuȃ ])‰i*%?D@ MԉȉFC FFFF C(FF F(C,F,C0F0C4F4t@C8S@FTEF8C< +>< !>< >< }>$< < lD$$3 D$< $ 蠩Í&'U(E ]]uE : D$${^E\$$i$豬]u]ÉƉ$蝬4$vU8E ]]uu}D$$|D$D$/$Īt@D$D$/$訪t$UR9wH)D$ T$D$$蟯 : E4$D$]$]u}]$7k %lj$˫<$#lj4$蹫䐍UWVS,}0{ D$($f6D$$n0D$$!D$$~*D$$f*D$$,D$$,D$$~,GpD$Gh$l,GXD$GP$j0G@D$G8$H,G(D$G $v'G$苪G$耪_GE9uC3$a$;uuH{ },[^_]Í$/$Q!$+$u+$-$-$-Gh$-GP$/G8$-G $(G$褩G$虩G$H{ $߉Љf뿉밉롉Ít&뎉|Ðt&bMf6!f t&UWVS,}0{ D$($3D$$-D$$fD$$'D$$'D$$*D$$*D$$)GpD$Gh$)GXD$GP$-G@D$G8$)G(D$G $$G$G$_GE9uC3$ѧ$艥;uuH{ ,[^_]ÉÍ$&-$$($($>+$0+$"+Gh$+GP$l-G8$+G $6&G$G$G$UH{ $W߉ЉÐt&뭉랉돉Ít&ydfM8f! fv'UWVS,}0{ D$($F1D$$N+D$$D$$^%D$$F%D$$'D$$v'D$$^'GpD$Gh$L'GXD$GP$J+G@D$G8$('G(D$G $V"G$kG$`_GE9uC3$A$;uuH{ ,[^_]ÉÍ$*$8$j&$\&$($($(Gh$(GP$*G8$q(G $#G$苤G$耤G$H{ $ǫ߉ЉÐt&뭉랉돉Ít&ydfM8f! fv'UWVS\E ]E : $D$U}D$k \$<$wWu؉|$4$uaEt$E$M4$蕣<$荣$]肣EuD$k $D$WD$y \$4$W$F4$uzE}̉D$D$`z <$U<$T$Eĉ|$$2$68 ÍEȉD$C$D$D$7 $Tt&4$踢e[^_]É4$E襢E$$E4$芢EE<$|Et&ԍ̍UĉE$XEE<$JE땉EU$跦UEu7Аt&kv'UWVS, EeU1Ҁx u x D$ $耣{ {]D$4z $D$.UD$9z \$$U$V$FX9uNt&D$D$$薵D$$9Dž : DžD : Dž : C$D$YRT$$A$s耠st$${D$D$p $]Dž : $D$QDD$$ä$$zD$Zz $T$wS@T$4$輞4$D$JQD$<$蘞4$耟<$Ɖ<$n$`Dž : D$Zz 4$P xDžDž[DDž<9É DZfCPD$$7 T$踢D$D$ $蠢$96x uTx uD$$s:뱉؍Dž : \$$$x4$D$ku+C߅tÍCt$$vqyC u;t#|$4$Tqx4$蘙vt$$D$2DPD$$7 T$dD$D$ $L뚋D$$$1Ue3 e[^_]ÍT$$LDž : &@Ho{C'D$$D$蓔RD$E$w$dÃ$ D$D$z $蔙\$$–\$$萟$蘗 <$\$谖$Dž8 D$4$nDžDžDžDžDž} Dž} $ V8 Í@t$$Cw C t$R } C~ C~ CCCC t$Rs t4$P Dž} Džw CCCt$R$衕D$0LD$| $蹛D$z $@6 Ë@t|? ~UF'$D$蟝$觙Dž : \$$o$賕DžDžD$ D$Yz D$Pz $NDžDžDžHDžDžDžDžƅDžDžt B $,8뱉$贒t&뾉V$ $|$ $E$藗$#\$4$D$$돉<$ԏʉ<$躏h$謏몉4$蜏뒉$~$`D$N t$$ D$$$0t$$.D$D$p $D$N D$$` DD$$x$躎$謎跔$莎$u$gr]$A؍$+‰뺐y$y$s]≅vl$跍t&v<$荍x$z4$l݉Ս|$NAbt&it&'Y<$$ 4$݉Չ1$h$譌$t&t&'<$mX$_Z4$L݉Չ24$$Q$$c뿋Åt$證$$ ׉$谋4$訋؉ȉƋt$L붉ËFt$3htd$z$aƃh4C$p9uhtd$$v蛇U1]ÐUEPr ]ÐUE@ tEBt&ÐU1]ÐD$ &US$]C } Cw t$R]$[]mt!$EUZUEt$G$ߋ$׋͐UEPr {UWVS}9ut&C3$艉$A9u[^_]É$͐UWVS] }tFt&C <$D$Cs$+C$ C$$ˆu[^_]ÉƍC$$4$?吐UEP$T$XÉ$U8]] uu} : 9tGE)D$$D$詎x t7U\$t$<$謉UBD ]u}]Ít&BB D אU8E]] u}t_$ƊƃtU$T$CD$ Et$<$D$VUC2Ћ]u}]t&C9EtE0EVxUEW9‰щUv9(҅uU+UY$34$v?$臎UWVS<]4$FFtE ǃ6 FpFuFxF|dždžD$E$Ʌ 0~ UAUԋ4~  CD$H $Љ,~ {8~ @<$|$P$螉MD$<$L$wt;D$H ${M $L~ ǃ`~ <[^_]D$P$pÉEЉ4$ӋEЉ$(EЉ<$ EЋ0~  4~ RC UEЉ$葅Ef琐US$]E  : $D$7$[]ÉE$NE$裌UWVSLU BM YM]‹@t9xM܋W9vыu9(uu)օxĉ‹@ 1ɅuDŽɋ]܉Ut$] E;C $萃M ‹YMrًF9ÉEw4}9(uu)ޅx#MAe[^_]ȉӃ]닋UEM܋] $T$L$ D$\$UEBЃ뭋UE\$$T$L$ D$]EC؃sD$AD$UVS ],~ 8~ ǃ`~ @C$׉0~ 4~ @Cǃ6 u [^]e0~  4~ RC 4$E/E$脊UWVS<}} E @ Ẽ}EE̋@ EЃ}EЋ@ Eԃ}yEԋ@ E؃}BE؋@ E܃}E܋@ E@ EtbX u 2&C <$D$OCs$a$uՋEX$DE$t]랋EX$E$t ]jE܋X$E܉$]+$8E̋X$ŁẺ$z]E X$衁E $V] z묍t&릃<[^_]뜋EԋX$kEԉ$ ]}EЋX$GEЉ$~]FO&CE؋X$E؉$~]7fUEP$T$É$.UWVS<}} E @ Ẽ}EE̋@ EЃ}EЋ@ Eԃ}yEԋ@ E؃}BE؋@ E܃}E܋@ E@ EtbX u 2&C <$D$OCs$$}uՋEX$E$}t]랋EX$E$r}t ]jE܋X$E܉$H}]+$؆E̋X$eẺ$}]E X$AE $|] z묍t&릃<[^_]뜋EԋX$ Eԉ$|]}EЋX$~EЉ$|]FO&CE؋X$~E؉$g|]7fUEP$T$É$΅UWVS<}} E @ Ẽ}EE̋@ EЃ}EЋ@ Eԃ}yEԋ@ E؃}BE؋@ E܃}E܋@ E@ EtbX u 2&C <$D$OCs$}$Y{uՋEX$}E$9{t]랋EX$]}E${t ]jE܋X$3}E܉$z]+$xE̋X$}Ẻ$z]E X$|E $z] z묍t&릃<[^_]뜋EԋX$|Eԉ$`z]}EЋX$|EЉ$ruʋEX$itE$[tE$rt]녋EX$4tE$&tE$q]8Ɖ4$a{ƋE$sE X$sE $sE $q] ,[^_]먉ƋE $s딃Ɖ$sf녋E܋X$}sE܃$osE܉$$q]nE؋X$KsE؃$=sE؉$p])ƋE܃$sƋE$rƋE؃$rUWVS,]C$KCECF@,C,C9B BBAB)i𫪪v.$]frD 9s3r]CC$PCFu {EuSS,[^_]ÐC1 tKCCF;BBAACBB CACFt뻐UEP;P t1Ív@0uɐUWVS,]C$C1EZCCS9t,S`T$D$C($CtCSC9uՐ1,[^_]ÍC;CtS`T$D$C($uC;CCu뻍vCS9tuD4mS$KCECFR,S,9B BBAB)i𫪪v2$]rD 9s3r]CC$N{Ftt&{EtC1 uDC{FCuًS9C;C f$buCKCCF;BBAACB BA{FCtjUWVS,]K$EC9CtuD4u&9CCu4,1[^_]ÐKCECF@,C,C9B BBAB)i𫪪v-$]rD 9s3r]CC$]M{Ft,[^_]f{Et8C1 t2KCCF;BBAACB BA{FCuC{FCu;CK$C],[^_]UWVS,]C$KCECFE@,C,C9B BBAB)i𫪪v3$]&rD 9s3r]CC$EL{Ft,[^_]f{EC{FCuۋK&9t t$ t t9ȉCu1,[^_]Í9ȉCJuD4tS$KCECFR,S,;B BBAB)i𫪪v2$]rD 9s3r]CC$MK{F{EtC1 uoC{FCK9 1'C1 KCCF;BBAACB BA{FC&KCCF;BBAACB BA{FC[Nt&C$4],[^_]VUWVS\]҉ t ǀS0ǃ C4C8C EECCC$EH,K,uEEt @(EăE{C EO7EC})iҫẺEЉUU9UvXMčI Q9W)Q iҫ*F ?RLỦPUЉPUԈP 9uXf9tt&ỦUЉPUԈP 9uU9Ut+UčE+UD$ L$BD$<$6K${MUMP UC A$rG Eu+FEظFuFFQE܋U؋{t@w WG tFu܅tFutFlC0‰C0uzK$Mʋ 1҅tQD$$C1uC$@0D @ r$ЉƋ $ǃ \[^_]ÍC$EEEt @(EEC 3EEC~uẺEЉȉMĉ)iɫMM9MMIMč}܉D$<$cEо:  9<$U܃ 9t e[^_]f}؉\$<$!E|$$gE؃ 9Eč}̉<$D$c<$D$]ԉD$$bẼ 9$DEԃ 9t#PWUT$$cCJ"MEL$$cEPUT$$qcPUT$$@ct:PUT$$c<$EbE$jPJHÉ$؉4$vӍȋPJHJyzPJH$PJHG&'UWVS]ЉEUT$$?aEԉ\$$0aEп:  9U]̉$T$ au؉\$4$`Ẽ 9BEUD$ T$t$$`E]EE؃ 9Eԃ 9u e[^_]Ít&7tEu܉D$D$ 4$5cEU\$]t$D$ET$ $D$$%'P UT$$GaPKUT$$a7P UT$$`tGPUT$$`lj$c`Uԉ$X`<$gPJH븉lj$7`<$glj$4$`<$uglj4$`랋PJHPJHPJHUWVS}] eE14$WdT$^4$D$:D$$^:  9$ 9D$ D$ $7 /gPD$$7 T$gD$D$ $fd|$D$]D$|$rD$$]| 9/$A 9t\$$.D$<$ 96dp$T$6]p$D$D$$]p 9|$l<$\<$D$|D$$\l 9mL 9 9Ue3e[^_]fD$D$ $7 TePD$$7 T$;eD$D$ $#e\$<$|$x<$[<$D$D$$[x 9/T$<$[H$`Y$9 ƅ(9 DžH6 Dž@DžD$ƅDžDžDžPDž$>_Džl7 DžH7 $|aHT$$_`D$$T$Z\D$P$` 9E 9td@T$<$0`-Z<$D$ D$$ Zt 99T$$Y\$dW<7 E@7 Dž\6 ECD$EEEEPE$]Dž,: Dž\@: <$_\|$$f]dD$<$T$BHJPJHVPJHd$U>PJHPJHQ`Qd<$Rd$Yd|$^Rd$Yd4$BRd$YddH$X<$ Rd剅dPJHCd<$QNdCd*BHJd$W$9 B􉕸(9 DžKd͋PJHPJHUWVS,]u}E $D$N{ sC : Xt CC$ S : @ : @ : EE$Sp @@t E܍E؉t$t$$SsE؉U؋U܅CSutFt6CU$T$ UED$C$T,[^_]Í&4$PFu4$P 멉$t&V4$s>Nlj<$VCECCCEE$U끉ǍU뽉ǍC$$<$VUܐUx}}]]؉uu$|$|N\$4$pNE؃ =: Ẻt$$E:  9M̅uEԋ]u}]f7tEu܉D$D$ 4$PE̍]UЉ|$t$D$ T$$\m$vPXUT$$NDtPPPUT$$N<lj$\N<$Ulj$ y4$BN<$UPJH뭉lj4$N<$uUPJHXUxE ]u}Eu؍]4$D$Lt$$LE؃ =: E\$$E: ]} 9ukt`7tWEu܉D$D$x 4$-OE\$ ]|$t$D$$k$'u&1]u}]ÐPxUT$$-MdtBP$UT$$Mlj$qw4$L<$TPJH뻉lj$L<$Slj4$rL<$SPJHXUWVS|}E]u܉$|$E3K\$4$'KE؃ =: EUЉT$t$$Eܺ: ] 9uЅu\$<$e[^_]Ít&7tߍEuD$D$x 4$eMEЍ]Uԉ|$t$D$ T$$j$\sPIUT$$K5tPPKUT$$SK7lj$K<$\Rlj$u4$J<$BRPJH뭉lj4$J<$RPJHXU< k< a< W< < ÍUWVSlE] xuxtep(P$Uׅu)t&FtƍF\$$!yF u9}t&GD$$!xGe[^_]Í&== u$= +G}\$]<$ EEEEPEEEEEEED$D$ = \$T$$]؉ƅtCEt$FU : JMEL$$IE=  = D$ D$e D$ $= p$= tID$$3 D$= $E$PC!$P Uƅt$E<$"H4$zO$ =  $= N4$XOƉ$Ny‹JYZ&'UVSP== u$= EE ]EEEEEEPEEEED$D$ = \$T$$]ƅtCEЅt$DP[^]Í&= = D$ D$ D$ $= 訠$= GD$$3 D$= $@Cv$PC^$P QUЉÅt$D$MƉ$w4$M$= 7$=  M4$MfUVSP= = u$ = cCE ]EEEEEEPEEEED$D$ (= \$T$$]ƅtCEЅt$ CP[^]Í&(= ,= D$ D$ D$h $(= $ = ED$$3 D$(= $Av$PC^$P QUЉÅt$oB$LƉ$u4$K$,= 臸$ = [K4$KUWVS EMDUDžHPXdDU Dž\Dž`@TU쉍hƅlDžDžDžDžt&@@@@@@@ @@49uEEL$$D$ݐ$\40u4t&Ft$@4;4t6^(t߉CuӋ$PCu$P 뵐t&tHt,s tFt(t$X@$P@0 [^_]Ë4$PFu4$P 뷋ƅt$ @4$IVÅt$?tH$$lI40u4^(tCFt$?4;4uϋtHt.^ tCt$D?4$$HUE@]Ðv'UE@]Ðv'UE]Ít&UE]@ÐfUU ER]UU E]UE]B+ÐU]ÍUE]P;Í&'UUE ]ÐUE]Ít&UE]@UEU SX JZH[] U0= ;4= 18= '<= @= ÍUUE  R)9s$ V>UE]uXtCt]u]Í&$Psu݋]u]@ ]fUE]uXtCt]u]Í&$Psu݋]u]@ ]fU(U ]Eu RtBXPtSt ]u]fE$RsEu܋$R EϐfUWVSDžl7 Dž\7 <$A\|$$>D$<$T$j:.D$P$c@ =: Qp)6@DtnC*&1ɅtNNC;C C9C v)V;VuǍD$T$4$A $P$t&uDžl7 Dž\7 Dž6 <$XB $Z>$Dž9 A$9 B(9 Dž\Dž\6 $=Ue3{|[^_]ÍD$D$ <$i;$T$8\$<$eA:  9|$$}8Dž8 D$4$;8DžDžDžDžDž} Dž} $ #=8 Í@t$$71Cw C t$R } C~ C~ CCCC t$Rs t4$P Dž} Džw CCCt$R$l7D$0LD$| $=PB$D$3=ƍ$<<$7$94$?$P($6u4$a9Ɖ<$=$9 (9 @Dž\$$=$74$t>빃9t& 9$8뽉2#Ɖ$6PVT$$6?PT$$6{ƍ $:<$8$9 B(9 Dž\$<4$v=PJHKPJHlƍ$e:Ɖ$V:$^:$耫Ɖ$5؋S Cw } Cw t$P$4iƍt&tC$4{4$I7D9ƍt&$#7Ɛ밍&'UVS0uF$ 7@@EE$7X @@Ѐ EE\$\$$E^UEۉF]tCtE 4$D$ 0[^]Ít&$PCuϋ$P ʼn$;$Z2E4$ E$a;E :Eڍt&UVS0uF$ 6@@EE$6X @@Ѐ EE\$\$$ӧE^UEۉFt]Ct 0[^]Ív$PCuߋ$P Չ$:$J1E4$E$Q:E8Eڍt&UVS0uF$ 5@@EE$p5X @@Ѐ EE\$\$$æE^UEۉF]tCtE 4$D$0[^]Ít&$PCuϋ$P ʼn$8$*0E4$ܥE$19E7Eڍt&UVS0uF$ |4@@EE$P4X @@Ѐ EE\$\$$裥E^UEۉFt]Ct 0[^]Ív$PCuߋ$P Չ$7$o/E4$̤E$!8E6EڐUEPr ]ÐU1]ÐUEPr ;.US]t"t$.][].&[]ÐU8]]uu }}C;Ct@1҅t PSBCB))‰D$t$$4]u}]f)Ѓ 9ȉM)ЉEMU܉ $r2U‰Et)ljD$E|$$Z4MT9{U܉$t$)|$;4U܅<:t$,E{ECEt&)щEn$ "+)ЉWUSEX tt$,][],t&[]ÐU]ÍU$D= ,D$$3 D$D= $ +轿H= CL= 9P= /T= 蕿X= Í&'UD$D$́ $7 6ÍUWVSL}=E$2E؉EĉE؉EEEUԾ@ E C J ߹KM  7h ;o  O|  K G C O    [ ;-$ r/tXU؉T$${3EE9Evu;ut)}kENL$$R46;uuE$R8t&E$REEE9E9뗍&E$R ֍vE$R ʍvE$R뺍vE$R몍vU$P(뚍vE$R늍vD$D$́ $7 31U;Uuڋ$$);]u]tSe[^_]ÐD$D$W $7 ,3D$$7 'D$D$E= $2D$($^'D$D$E= $2D$$4'Ë@t|~F'D$$D2$L.D$ D$\ $7 p27 @\8 `{C'D$$7 1$-t&U$P$ENL$$R46;u9uuދENL$$R0f4$'D$ 4$P vD$1D$́ $7 1e[^_]Ë$P{/$P "t&U$Pt&:v$ 'D$ $PvE\$$R,U؉;Ut$&%t&%]tKt4$0$PSu$P ڐUչ\= [`= Qd= Gh= 譹l= ÍUWVS,E0FEE C;uEt@9uRf9ut-9]ft>$s/$f/)t҃,[^_];],[^_]Ðt&,[^_]ÐUp= 苸t= 聸x= w|= ݸ$= = %D$$3 D$= $ $Í&'U]Éu@$(D$ t$$D$]u]Éƃ$4$Q.U = ]u}t1At؋u]}]Ðt&}EEEEEEEEEED$D$D$= |$ T$D$4$(4$ZÉ4$h<$XYÉ<$ X$s-É4$yh䐍UWVS== < ==  EUDžd`E$l hd`p UЉD$$$U D$EЉ$&UD$$w$EЉ$\%UE\$T$$U$8%E$QUET$$3U$ǍE$$X'@ E@@@ @@@@@$x,= C0= C4t@C8{LC<EC@CDCLCPCTD$D$<$o-]E$ 'X U@@`q E\$\$$\]CHs(t$C8\$D$C0D$ C,4$D$ZgCLCH2 C)i9 k S+pX<;X@tD$4$D$#;_uE܍UE : $D$hE Uĉ$D$!EȉD$Eĉ$DU؉D$$!Eĉ$z"Eȉ$o"4$g"EU؉T$$UU$*hE؉$?"U]҉pU$ǍE$$X$@ @@@ @@@@@$x,= C0= C4t@C8{LC<C@CDCLCPCTD$h D$<$*CP;CTt CPCP]E$$X @@`q EE\$\$$S]CHs(t$C8\$D$C0D$ C,4$D$QdCLCHx C)i9k SPPXP$P$= P$;PP$4$P뉅P4$lUԉP$aPE$s{d$V$PƋt$C4$P2{$8$P" fPPPD$$_{pD$$L{;pP$=  P$ ỦP$OPDP.P$= @ USEM P)iҫ9}x I[]f[]ÐU(U]E u}019t C0;F0t]u}]Í&C,;F,uߋC8;F8u׋CH;FHuD$4$HD$$6;u4$D$ D$$@;F|9pt&1UEPr ]ÐU1]ÐUEPr U8Euu }}]tdE$Ãt|$$GCFD$ E\$D$E$*EF]u}]fF9EtE<$D$Ezn$* $m6 4$~ UWVS9␐UVS@ vC$C$C$C $gC$g= u[^]ÉƍC$C$C $g$g4$ډːt&UWVS== u$= E : E |@$<p@@@ @@@@@ @$@(pP,= C0= C4t@C8]E$uX @@ E܍E؉\$\$$fE؋|P,H(H8|D$T$L$H0\$L$ $u%EEEȋEEE̍Ẻ$f]EEuep+|~/1ې|MD$ $D$)؅ԍEԉ$eE܉$eEĬ[^_]EE1t9S0;P0/ S)ʃY 3{)~(1D$D$E$E)؅ڋ U]T$$L$ = ]EIPEEMMEEMMUE$MDXEEE =: 5]؋KC)Ѓ#~JI|M܅t I$<@ƋC1+FiЫFEtUUU<<$EEljF~{Ex9>tt ZJXH 9uዅxMt )iǫ*%?D@ MȉFC FFFF C(FF F(C,F,C0F0C4F4t@C8F8uE$@U@ p E$t$t$icEU؉E؋E܉UUEEU܉$b]؋C)Ѓ#~oJ;JC8tjS(D$C0D$ \$T$C, $D$'tKC(C ]؋EЅ )ʃ KC8@두t&EEEEEEčEĉ$3b딋S,;P,S8;P88P)# sS)ʃ#~q6;7D$$D$$x@;Ft]؋ S)XE p+|1f|D$D$E$)؅D$D$Ċ $= 3G$= 'D$$3 D$= $x$v4$;P6NjU$<$AEԉ$`E܉$`ΉǍE܉$`뿉$$Olj4$T븉봍Ǎt&믉$= P<$t6PUT$$Mlj $.OPJH9"ft&'UWVS== t#E> @[^_]$= t͍E卽@Dž$D$D$ <$aE捵DD$D$ 4$DED$ H$D$& D$$T$&ED$D$ $E|$t$\$ D$T$$> \E$^$^H:  9 D 9K,@ 9)ED$4Dž$D$\ $AE㍽8D$D$x <$$ E䍵 6D$]$]< 9,8 9)4 9W&E߉D$(Dž$D$4 $ E,D$D$( <$ E፵0D$4$T$ D$$D$BD$D$\ $B(T$|$t$ D$T$$8> C$\$\0 9P), 9g,( 9&E܉D$Dž$D$ $Eݍ D$D$ <$ Eލ$D$4$T$ D$$D$AD$D$ $AT$|$t$ D$T$$T> A$v[$h[$ 9) 9& 9K#EىD$Dž$D$l $EڍD$D$̇ <$ EۍD$4$T$ D$$D$@D$D$l $@T$|$t$ D$T$$p> @$UZ$GZ 9s' 9) 9&$E։D$Dž$D$ $E׍D$D$އ <$ E؍ D$4$T$ D$$D$?D$D$ $d?T$|$t$ D$T$$> ?$4Y$&Y 9' 9$ 9n!EӉD$Dž$D$ $EԍD$D$ <$ EՍD$4$T$` tD$$D$a>|D$D$0 $C>T$t||$t$ D$T$$> >$Xx$X 9g$ 9% 9!EЉD$Dž$D$ ${EэD$D$ <$^ EҍD$4$T$? dD$$D$@=lD$D$ $"=T$dl|$t$ D$T$$> p=p$Vh$V 9! 9p 9$E͉D$Dž$D$ $ZE΍D$D$/ <$= EύD$4$T$ TD$$D$<\D$D$ $<T$T\|$t$ D$T$$> O<`$UX$U 9 9{! 9<EʉD$Dž$D$h $9EˍD$D$p <$ E̍D$4$T$ DD$$D$:LD$D$ $:T$DL|$t$ D$T$$> .;P$TH$T 9# 9$! 9EljD$Dž$D$ $EȍD$D$ <$ EɍD$4$T$ 4D$$D$98$>4$ <$ 9u^$= D$$3 D$$lQPUT$$PNT$$rPOT$$wpP1QT$$CPPT$$PRT$$nP^T$$P XT$$s PgcT$$?PPUT$$ P!aT$$ mP/[T$$VPeT$$opbPST$$;[Pa_T$$JPoYT$$X!PdT$$PWT$$kPpbT$$7YPm]T$$VPfT$$PhTT$$QP`T$$gPZT$$3PVT$$PF\T$$/QPgT$${Ps}T$$c\PsT$$/PUT$$PmT$$yPuUT$$aPyT$$ePUT$$4xqPjT$$#PT$$PvT$$#PUT$$gPpT$$3 PUT$$eP{T$$PUT$$1POiT$$i8?P4~T$$5PcuT$$LEPYUT$$EP@oT$$)P6UT$$k"tPhzT$$7QPMUT$$95PkT$$ҿP|UT$$衿hPwT$$mAPUT$$<PqT$$PpUT$$׾\JP|T$$裾PUT$$rP5hT$$>0PUT$$ PLtT$$ٽ5CP UT$$訽 P)nT$$tPUT$$CZPPxT$$9PUT$$޼PolT$$誼XP#UT$$yPrT$$EP|UT$$h$/$/$荻4$y<$e+$k> > t$&PJH;$= $fLat&lvx@$.8$.4$詺<$蕺${ PJH봍&뿍$/$$$ܹ4$ȹz<$诹뷍P$-H$y-t&멍눍뀍"t&',t&'$ $$y$ĸ4$谸z<$藸뷍`${,X$a,t&멍눍뀍"v4t&',$$$ $ӷi4$贷4$蠷z<$臷뷍p$k+h$Q+t&멍눍뀍"v4t&'x$*4$<$϶8$赶KɍՍ$*tPJH PJHPJH8$A*4$-<$$뷍$)끋PJH{뱍t&\PJHf4$蝵<$艵$ofۍ$?)$%)oߋPJHPJH$($(4$躴<$覴t$茴"뵐t&΍PJHpPJH$3(4$<$ h$뷍t&ōэlPJHfPJHPJH*$'$q'4$]<$ID$/f볍뿍PJHfPJHPJH6$&4$跲<$裲P$色뷍$h&끋PJH PJH!PJHv눐t&PJHf$%$%4$ɱ<$赱\$蛱1띋PJHPJH1뫍뷍$G%PJHPJHoPJH9P$$H$$4$а<$輰$袰8띐t&밍뼍ȍPJHPJHX$C$4$/<$$뷍`$#끋PJH뱍\PJHf4$蝯<$良$ofۍ@$?#8$%#4$<$$yPJHPJHPJHp눍&듍럍,PJHfPJHPJHE$K"4$7<$#$ ɍv'э$!pPJHMPJHPJH\$!$w!4$c<$O$5뵍PJHPJHPJH4$ 4$<$譬$蓬)뷍 $r 끋PJHPJHoPJHv뇍PJH0$ ($1ߋPJHPJHn4$谫<$蜫$肫ːt&؍p$Oh$5lߋPJHPJHx$4$<$Ъ$趪Lɍ&ԍ$sPJHPJHPJH=$A$'4$<$${뵍dPJHPJH1PJHK$4$q<$]$C뷍$"끋PJH*PJHPJHb$$4$褨<$萨4$v 뵍&̍PJHfPJH$4$<$($קmɐ&ӍTPJHfPJHPJHt&$t&' PJHfR$G$-4$<$$띋PJHPJH뫍뷍L$_PJH7PJHPJHCUU]B+iЫB!ÐUEPr ]ÐU1]ÐU]]uu C4$艧Ut$$T$ D$]u]Éƃ$4$UEPr [U8E ]]uU}@ Ct@CBC t@E{<$D$QEs4$D$?ED$C$-]u}]ÍS E$$E$LE4$EE<$ӤEUS]E {w,S$x fR $D$QSSt&D$D$C$膥[]ËR D$$QȋR $D$QSSfR D$$QUWVSu };^tf<$D$&;^u[^_]ÐUVS]S B;CC SrNv_Cu V0s D$ D$t$$"LD$C$ $D$At&$ KPS 9x{)у2 C D$ L$D$$B"D$$D$ $C t&[^]ÐD$ $C fD$ $C fD$ $C fD$ $C fD$$C fH;KK yPC $ʃ(҉T$IDt&D$$0C '&$ C CCCC CCCC CC CC CD$\$vC PS PC $T$lg&uFCfS C)ЃS ~D$ D$t$$- C C $T$vC BK $D$t&C C D$ L$D$$xlS  }tG\t S :\uBC BS $D$ytD$x$d_S D$$JED$x$5D${$% UWVS<E ]EC S)ƒU}9 %}PS tx}?C CP$D$$D<[^_]Í&C 8^rSC )ƒUlt& }I }+  h} } }PS t x}u<C CP$D$$G}PS tx}tC 1<[^_]ÐC {G)Ѓ#;79wt&$D$6;wu&zÍv}PS t x}u C {G)Ѓ~9z 79wOv$D$;wu0&t&1.&}P S tx } C D$C$t&}PS tx}S C$vC$PT$막T$$臖oT$$vaUS$]t2C4$C $t$N]$[]A$[]Ët$E)E$辣$EE$訣US$EX t7C4$$C $t$˙]$[]龙$[]Ët$E衙E$6$E+E$ UWVS,]s SF9ЉC hF<'<`N<{t&<+E1C D$ T$D$$xS ;St :}E$D$>,[^_]Í<$td<&fu{s G)Ѓ#z79wtōv$D$;wu,[^_]ÐFC E8s $D$$,[^_]fSs :B) z7;wGt&$D$;wu,[^_]Ð{s G)Ѓz 7;w$D$>;wu,[^_]ÐF;CC t ~{C$pvC$[PT$C$Y$D$K1Q)iҫ9}v@E‹29rtt&$D$E;pu.C %vs $D$fC t&&M닍N9щK t^~}tk9ЉC tF8}usV:D$L$$~8D$4$\D$$C &K t&Fω릐UWVS]C 9Ct+Q܀8v(ɉL$$C 9CC u؍v[^_]$ $@C 뫍vCFC $C 닍vCt{ uD$:t&녍Ct&uD$)$C C @Cs C C $C ;Ct%)t҉C T$$C ;Cu;CS C{C W)ʃ#y79w&$D$6;wuC Ct&$C jfD$(vD$?bvC D$&$C *ffUS]$C ;Ct%)t҉C T$$C ;Cu˃[]ÐUWVS]s C9>{)vD$C D$ D$$6K1Q)iҫ9|<yt?C $?C ;CC t 8:[^_]f냐@ yusC C$C ;CC st8:uC ][^_]t&~{ D$C D$ D$$exYS :}t!s $D$?6[^_]ÍS t&sC C$@sC S9t8}t 9ЉC uSR D$|$$knUV: S ]C 9u1C 9uwC 9uGC $7$, [^]úPUT$$=륺txPUT$$듺t9PpUT$$\ƃ$4$PJHċPJHjPJH념UWVS,] }Ev< tM< t=EE$R9؉tyډދE$R9,Ɖ[^_]Ð} t} t뱍&'UW1VS] ut&< t5< t%NjE$MR9ty݉؃[^_]Ív t tσʍ&US4#@ E#@ ;#A 1#A #$ A A 膐D$$3 D$ A $ 躎ED$D$p $A ϓED$D$ $A 诓E1ۉD$D$ $A 蒓D$$3 D$$P2F4[]ú)ڍA A tE$|EՐt&Ή$vØvUWVSӃL9ʉM : uz<><&HPUԉMă;JMwR~E<$D$;PUċUĉ MB@JD 9]t)3<X\t @j$X6NjF1+GiЫGDžlt!UUU$llˉO_^d9Ӊh< Tdt ZJXH 9uዅhdlT )Éi*%?D@lыF OGGG F(GGG G(F,G,F0G0F4G4t@F81ۋV@GTG8FÍl$t.P3T$$)uPJHϋPJH=É4$É4$9Í$fÍ$t9ωÍG4$uG $jt$r<$rsÅt$qXzPJHAz7${<$sFrË4$D$JHÍvyv^Hvƅt&ZÍ\$$nz4$&sqNjt$!qF4$VF $Kt$p4$pÅt$piÍvyZÉ4$É4$7Í$Í$7~&H TXu&`H$耉L$D$ RGtJ ƅGz0?H$T$`°T$ Q}e3=u3e[^_]ËH$D$`hD$U QnupÉ։ $q$x$R1T$$@6 уL$y@6 @􋘼6 {C'D$$@6  y$uOw$1ql$#qh$qG`H$˜T$L$P R01ҿ8$@09< < 뻉Ël$/nà : ZJ=D$$_p&à : tTJD$$p$,A $ A vJABmJABt:PT$$okÐt&EPJHËà : it=JPD$$Fo92PJH9JAB݉$ul$"mtt t f8$.dډ91\8$-9tx< tD< t4̉XӋ8$-9t$< t< vtۉ t t뻋8 $z-9É*/ #D$ T$D$$<T\؉lh lD$D$+ h$QtThd\$l$t:  9SlD$D$/ h$sdhXE\$l$t 9T\ht]PHZ;Ywy~'\$$h^tP B@ZD D$D$+ $hrDž\h\h$4A D$jt$ $rs\$$Zs 9\\tVPHZ;Ywy~\$ $]sP B@ZD :D$D$/ $qXd\t$$r4$jD$$il$L$iH\$<$viLD$$^i``XKHD$C$AxKCX҉Ë 9u:$il $ih<$i{C X뭺PT$$i뙺t|PL$$iË 9V1 P9T$$Zi"PJHcPJH끉 PVT$$i?à 9uAhtPPT$$h}t+JD$$h떋PJH뭋JAB҉É<$(h$h<$ hۉÐÉ4$gÍL$g뭋X9։LHЃD$ $b?L|$$ElLLL$$*lL$lg<$dg $Vg$Hg`zЃpD$ $1fHC C @Cs C C $C ;Ct%)t҉C T$$C ;Cu;CS C{C W)ʃ#y79w&$D$;wuC Ct&$2C jfD$(vD$?bvC D$&$"C *ffUS]$C ;Ct%)t҉C T$$C ;Cu˃[]ÐUWVS<]s S9t.<{tk)<"?$G$> ?Ɖ4$GUET$$Q>F4$GFɍt&␐UWVS,U]E$,6Cljƃto\$<$Q?FS FF(FF ҉F$t>D$FT$$)Ft&ыRuN t&‹@ uCV$F(E t$D$ ED$E$^CE @E0,[^_]E 9E03FEExGEE9v9(҅uU+UUÉ$$5<6ƍC$迻܉=4$>?UWVS<} uGtEMvË@t9PË@ 1Ʌuɉu9P|.Fe[^_]_f;_ t$C6M9P}ҋUE\$ |$$T$D$EFe[^_]UHuu ]]}}F9C9}^F 9$3P;H |$\$ \$Ut$$BE]u}]t&F9$t&7;P}LS |$D$ D$Et$$E뚍^tFP;|?&E$|$t$5EUЃWvEJ|$D$ D$끍|$D$ D$&|$\$ D$U0A [4A Q8A GD$ $t$$$54$xX0D$ $7 t$$kD$ $)߉Ɖ\$D$?\$8D$ |$$+\$4$$4$op4$$qƐt&퍶UEx ]ÐUEx US]Ct$'C tEB[][]ÐUE@]Ít&UE@]Ít&US]E C[]ÐUS]E C[]ÐUS$ED$E D$ D$D$D$$A A =A C t 8u$ jUX@A D$D$ $fUS$]t0Pv5v#vD$o $4t&$[]f$ $H D$; $w΍D$ $w릍D$ $\w&D$D $,G&P T$ @D$ $D$F PT$ @ D$8 $D$P|T$PT$PT$ @ D$4 $D$fD$ $w&PT$ @ D$ $D$k6PT$ @ D$ $D$5Pu@ D$ $D$t&D$ $&Pv0T$ @ D$ $D$tt&$\ &$ &$ &$ @ D$ $D$N@ D$V $D$.@ D$ $D$@ D$ $D$@ D$ $D$PT$PT$ @ D$ $D$kPT$PT$ @ D$ $D$r=PT$PT$ @ D$ $D$DPT$PT$ @ D$ $D$PT$PT$ @ D$D $D$PT$PT$ @ D$ $D$@ D$ $D$e@ D$ $D$zE@ D$T $D$Z%@ D$t $D$:@ D$ $D$@ D$( $D$@ D$ $D$@ D$ $D$@ D$p $D$e@ D$ $D$zE@ D$ $D$Z%@ D$ $D$:@ D$4 $D$@ D$ $D$@ D$ $D$@ D$X $D$t&@ D$l $D$`@ D$  $D$u@@ D$D $D$U @ D$ $D$5UExu Í&D$T$$Ív'UExu Í&D$T$$Ív'U8E]M ]uU} Cu]u}]Ís1#t$D$U$1UKt C묍&ҸuPCC $Et D$t$$G$/CT D$D$ $$`C D$D$ $$*C( D$D$ $PU8E]M ]uU} Cu]u}]Ís1#t$D$U$UCt C묍&ҸuPCC $}t D$t$$;G$CT D$D$ $<$yC D$D$ $$CC( D$D$ $UU :t*`A  U U $T$fzuЋJuÐ&UWVS\]`A u}ECE t$|$ D$EԍCEEԉD$E$a(EEԉt$|$ D$D$E$6HEEԉt$|$ D$ D$E$ hEċEԉt$|$ D$D$Eĉ$EȋEԉt$|$ D$D$Eȉ$E̋Eԉt$|$ D$D$Ẻ$EЋEԉt$|$ D$D$EЉ$_E1}t$|$ D$ED$$.ǃ ǃ `A [~$E$t3]EEE\$$tqEu\[^_]Í&uE ED$$u$C D$D$ $$$aC D$D$ $ËEĉ$E$E${E$p$Ӊf؉߉ËẺ$MEȉ$B뤉ËEЉ$/ՉËEԉ$ 䍴&'UWVS\]`A u}ECE t$|$ D$EԍCEEԉD$E$A(EEԉt$|$ D$D$E$HEEԉt$|$ D$ D$E$hEċEԉt$|$ D$D$Eĉ$EȋEԉt$|$ D$D$Eȉ$E̋Eԉt$|$ D$D$Ẻ$jEЋEԉt$|$ D$D$EЉ$?E1}t$|$ D$ED$${ǃ ǃ `A ~$E$t3]EEE\$$tqEu\[^_]Í&uE ED$$_u$wC D$D$ $$AC D$D$ $ËEĉ$qE$fE$[E$P$hӉf؉߉ËẺ$-Eȉ$"뤉ËEЉ$ՉËEԉ$䍴&'UVS ]C~ $BEEEED$$P`A t |D$D$$t \D$D$$Xt <D$D$$/t D$D$$lt D$D$h$Lt D$D$H$,t D$D$(${ tD$D$C$h [^]$EF D$D$ 4$kƍ$ $$$h$H$($$4$t&US ExPMAʉD$BD$ BD$D$L$`A D$ $MA tjM $L$RÍL$؁ []$ MQAt7$UBJ1UHU $R떐Aҋ`A $ HD$D$ $ÍL$g$o&'US] tE $D${[]Ã_t&V t&  M t& t&?t&t{tb$D$ $d1 $D$ $D$8҉$$1$$띉$yf븍밉$v[Ë$D$ CD$ $D$G$#$RD$D$ $C'5$&$RD$D$ $;$$RD$D$ $t&$&k$RD$D$y $b$>$RD$D$a $5^t&U$&$RD$D$L $[$$RD$D$6 $.t&$&$RD$D$  $$^$RD$D$ $U~t&u$&$RD$D$ ${$$RD$D$ $Nt&$&$RD$D$ $ $~$RD$D$ $ut&$&;$RD$D$ $2$D$ $D$t 4v'%v'UVS ]K~ $rEEEED$$JP`A t |D$D$$t \D$D$$t <D$D$$_t D$D$$6lt D$D$h$ Lt D$D$H$,t D$D$(${ tD$D$C$ [^]$uF D$D$ 4$ƍ$;$-$$h$H$($$4$t&U]] uu;t1$-t1D$4$tK]u]f{uɋSt;t&t^`A U  t$$$=C D$D$ $cv{uCuvRU]Ít&'U]Ít&'U]Ít&'U]Ít&'U]Ít&'UWVSÃ\eE1uD$j D$ D$D$D$4$}ut8uE$(3 aD$D$k $.SC <$T$)ЉD$ dD$D$ <$CEĉt$<$)D$%D$D$  <$SC<$T$)ЉD$D$D$ <$k{t!D$D$! <$DD$D$' <$#t~D$D$0 <$taD$D$8 <$tDD$D$  <$t'D$D$(3 <$(3 ut&1ۉ<$VUe3u \[^_]1É<$-$et&UWVSl}F F F F UeE1T$D$> D$ D$D$<$FD$<$E ^D$\$$DFt!<(u&t <(uCS<)u ft <)uCUt$D$L $UE^ D$R VD$D$ D$D$<$ZD$\$<$ft9Ƅ  FE^ $Ee3u$l[^_]Ðt&E$mڍv?;ËE$N$UWVS,eE1df9tw)wpDžc )_ tT_ x1:t[vLT8uG9u닅9t=^ u]`1Ue3uH,[^_]Í&9tzDž_ 뎸'UED$$ÍvUWVSLEظc &8uE܋U؋E؁}c Ec R@ UE9]܉Ǎwc ]9u]&U\/: f !]f 1f8H8HP 8HP8HPЃۍPNjE)Ѓ\@)w9uYEcE\/: f dUj uU%f8HtV8HPtN8HPtF0ƒ8t8m]ЍPϋuUЋE+EЃu,8u%9Ut uf 9U09uuf}U؋]ԋ)|$\$D$D$f D$ 2D$D$2$C SLC [^_]8t8t8tfE̺c c _e Ud Kc 8!: f c e d 'UWVS,} u tv\uE I 9vӋM tEf18t8uNjE+}I )9sE 1,[^_]Í|$D$$ۉE I 9EI v]U1D$n $T$>E U\$D$n $1҉؀;tv8u)ڸI +E9sU1,[^_]fT$\$E$UEU܉E tQ¸I 9EI Y>U䍗E UVD$E E$1 Uh]]eE1u} uD$j D$ D$D$D$4$S{u {D$ D$CD${ D$ D$D$D$$C D$$t$ |$D$C D$ D$ D$  CD$ $ D$'Ee3u]u}]Í M'UWVS]eE1'}D$j D$ D$D$D$<$$Su {D$ D$CUD${ D$ D$D$D$$C UD$P|$LD$DC T$HD$@ D$< D$8 D$4 D$0 D$, D$( D$$ D$  D$ D$ D$ CD$  t$D$ D$$H Ee3uĜ[^_]Í& QUX]]uuԉ}eE1D$j D$ D$D$D$4${u {u D$ D$CD${ D$ D$D$D$$C `D$t$|$D$ C D$ D$ $ Ee3u ]u}]^&'UX]]ujƉu ]u]ÍvtD$HD$DD$@ D$< D$8_ D$4 D$0 D$, D$( D$$ D$  D$ D$ D$ Ct$D$  D$ D$$H ]u] UVS ]eE1t}D$D$ D$ D$D$4$Ct@S9StOD$t$D$ T$D$  D$D$ $R Ee3u9 [^]ÐD$t$D$  D$D$ $R t&U(Et(D$D$ D$ D$ $_ fÍt&UWVSEeU1҈wy&9)Džxc )xx_ tdq_ x1: t &LT8 9u狅9xt =^ H}ƾ& ]Ɖ$ƅtt<DžDždt$D$ D$D$$D$$twƅ<$ƅUe3e[^_]Ít&9xDž_ Dž Dž Dž Dž Dž Dž 9w$ u:u؉8uD$C $C @t@t\$T$ $PV$ $É<$*$b XÍ$7&v'v'US4]C D$C$ =: u4[]út3PUT$$ԉE$aE$PJHʍt&'UWVS$ C  : C C C C C C C E]̉D$D$D $\$$C jẼ =: E}ȉD$D$_ <$_|$$C $Q @EE$,X @@! EE\$\$$6E^UEۉF]tCZEȺ:  9E]ĉD$D$N $\$$C D$ $5Eĺ:  9E}D$D$D <$H|$$C $: @@EE$X @@! EE\$\$$h5E^UEۉF]tCkE:  9E}D$D$X <$~|$$C $p @EE$KX @@! EE\$\$$4E^UEۉF]tCE:  9E}D$D$ <$|$$C $$ @@EE$X @@! EE\$\$$3E^UEۉF]tC/E:  9 E}D$D$c <$|$$C Z$ @EE$X @@! EE\$\$$ 3E^UEۉF]tCE:  9Eߍ}D$D$m <$ |$$C $ @xDž|$X @@! |x\$\$$42x^x|ۉF|tCE:  9Eލ}D$D$w <$>|$$C $0 @pDžt$X @@! tp\$\$$R1p^ptۉFttC1E:  9%Eݍ}D$D$ <$\|$$C $N @hDžl$#X @@! lh\$\$$p0h^hlۉFltCE:  9D$$3 D$C $HĜ[^_]Ðt&$PC$P ~$PCz$P m$vPC$P t&$vPC$P t&$vPCM$P @t&$vPC$P t&$vPC$P t&$vPCc$P Vt&E]̉D$D$_ $޻?PCU܉T$$/P3UՉT$$PUډT$$軹lP[U؉T$$芹GsPdUӉT$$YPPU׉T$$(PUۉT$$PUىT$$ƸPUԉT$$蕸t2PU։T$$hPJH!PJHˉƉ<$C $C D$[$C ߷4$7ӉƐƉ$ķf$v裾$P͉f諽둉$聾$Pĵt&qvҍ뗍돍뇉$vC$P膵7$)$Pl&wt&'t&'$$&۽$P/vt&'$&蛽$P޴vt&'$&[$P螴$F$P艴t&t&'!t&'DPJHfHPJHPJHPJHDPJHAPJHPJHPJH='UWVS\Eu] D$C $莴)؉D$\$$C FU҉UC EC tW C YM]vPEt7MЋpV9vы}9(u+uyƋP uɋ]C ]}؋5C x^G9؉w^9(Ʌu)xK]Ct@UMZJBtCEe[^_]f랍t&uEED$C 4$OE܉EԋEt@UE؍Eĉt$ D$C T$$]؃MąۉMtCEЃ =: ]Ct7EEf$PC$P $vPCt5UU$PC\$P O$P M My]]lÉ4$E$'E$$O޺t9PUT$$븉É4$t&諲뜋PJHĐUE ]ÐUE ]ÐUEPr ]ÐUE@ tEBt&ÐU1]ÐU8EU؋PU܋PUP UPUPUPU@EE؉$E PEUE {UE [UEPr ;UVS u$9E E ]C$X @@! EE\$\$$h%E^UEۉFt]Ct [^]Í$Psu$P ׉$蛷$Pޮ觶4$U(uu]^tCt =: u0]u]Ðt&$PCu΋$P ĺt/PUT$$;몉É4$$GPJHΐU8E]]u}tw$膲ƃt \$$裮CFCFt@E t$<$D$ ED$E @E0]u}]&E 9Ez3FEExGEE9v9(҅uU+U=$׵4$蟬$+UWVSLU BM YM]‹@t9xM܋W9vыu9(uu)օxĉ‹@ 1ɅuDŽɋ]܉Ut$] E;C $M ‹YMrًF9ÉEw4}9(uu)ޅx#MAe[^_]ȉӃ]닋UEM܋] $T$L$ D$\$UEBЃ뭋UE\$$T$L$ D$]EC؃sUWVSLE 9EEMISAMԉU9ЉEwb}ԉމ9(uu+u܅xFu9(҅uU+U؅EMȍe[^_]f뚍t&E U9P q$iU:p_NM܉;]9(ɅuM)مyiH VML$ED$ D$U T$M $bEe[^_]fE XtUT$@$UET$M $L$EUЃe[^_]MCM E9A$)Í@D$U$蕪yMQ t5E\$ \$D$U /ED$U BD$D$ EL$ D$D$U &MT$ T$D$L$E$BEC&MD$ D$L$E D$U$ E UD$ D$L$T$wUWVS\EUEEBtZM YM]&PEt7MЋpV9vы}9(u+uyƋP uɋ]9]]tLE {0GV9w09(ۅu)ÅxEe[^_]Í&̍t&U uEE4$T$ШE܉EԋEt@M]E؍Eĉt$ L$\$$?]؃EąۉEtCtUEЃ =: ]WCB$Ps,$P $PCu$P 늉É4$E$$=t6PeUT$$QÉ4$&봉f뮋PJHǐUWVS<} E @ Eȃ}UȋR Ũ}pE̋@ EUЋR ҉UWt&EԋX u(t&C =: ui$蹥C D$E$Os{tŸFu4$PFu4$P C =: tPUT$$迧wC UD$$s{tFC =: $uEԋXptCUԋB =: \Eԉ$詤uUЋZrtCUЋB =: EЉ$_uNŰZrtCŰB =: Ẻ$u$PC,$P $fPCN$P AƋEЃ$4$GUȋZrtCUȋB =: Eȉ$ju.U Zrt Ct#U B =: u2E $-u $PCuȋ$P 뾺PUT$$^뤉ƋE $PC0$P #t<PUT$$ ƋEPJHvPJH<[^_]úPUT$$訤ƃ$V4$讫4$PF4$P PJ҉HUT$$HPJHvƋE$PC\$P OtQPUT$$ݣt9PUT$$谣wPJH묉ƋE\PJHĐU8҉]Éuu}t~E$$ƒt*$Et$轢EVPVPV PVP U|$D$ED$ LI $dEu}\I ؋]]ÐLI vA9FtEgF;A䐍t&UWVSӁLED$D$I $}E]D$D$! $MЉ\$ $>uЍ`t$<$DžlDžpDžtDžxDž`} Džh} $ |$Ɖ$&h} F~ F~ D$F$ <$2D$0LD$| 4$f=I {PI FKLI 9H%„ Ƌ@uLI F9CF 9DI }}}ċF 99T$D$<$ɡE=@I t@I tT$D$$@I 衡DI F ]9u#4t&$09PPs Pt׸Fuȋ4$PFu4$P 맍&@ t&vP;Sf$`̢Ɖ$\$螟CFCFC F 4$ ,48Ddž$dždždž<dž,dž0džTdžDdžHLP4$puE$@@, p E̍Eȉ$t$t$IEȉEE̅Et@E$袡tUPU҉P tBUPD$@I $蓥E$}5DI <$\$3C|ECEC |$$EE|uuL$4$LI EEEEEEM}EEM}EPI Ƌ@ ;H„uƋ@ t&$I $q$I @I @I DI @I \I LI PI TI LI XI LI ZD$$3 D$@I $DI P@ LAt@M؉ $L[^_]ÍKC;Ff;xt&҉uz9H}<$[|$MU$BPI =DI sLI t&PtY;pt@„tP f;5TI t4$,Mj@;EhP;S븐t&=LI tP9S„tLI  \I GDv?5@I @I t1t&F t@tQvPP@I t Dw+EȋLE̅Bt@Ẻ$XfP렡PI ~PH<\WLI H@9t$t&„t+P ؅ÉЋH9uድHP;V„u9t„t#PʍHQ;P&x @H@tF8 Gt/9WtuG t&H@;G⍴&8tZ@yt9ȉ9QtÉ߉ty ፶HY;_Éڐt&@@HTI ;@@;HuDt&$ƟD$LI $Í@$g$-\I 9Hu4$XF $ 4$UD@@H[HLI b<$HI |$TI LI PI XI LI \I mt&U$T18LI lS;P}T1҉<$LẺ$ E؉$ L$M|uL $"$4$밉LE$_ 땉$&;4$6~L$0vL0fL[L<$BXHLfu*Fw L4$d4$\<$ }Љ<$蹜|t&볉L҉L끉L4$.4$FËHD$@$w.L0D$($ 1D$$a34$ɞ뙉L뾉L扅LƐUEP ⵃP ]ÐUEP ⵃP ]ÐUEP ⵃ@P ]ÐU(]]uu }C~t$R{t<$P FCF C FC]u}]ÐU`I ]ÐUEU PPUP ]ÐUE, ]ÐUS]CL;CHt0C<uS@ډ$Єu[]Ðt&S@ڋ Dߍv[]ÐUWVSEu xX)~+ &t;rv)ɍZٍt&9t;st[^_]Ðt&[^_]ÐU1ɉ'VUu S9t>fȃy719uȺ'i)э'[^]ÐUEPr ]ÐUEPr ]ÐUEPr ]ÐU1]ÐU1]ÐUE@ tEB t&ÐU1]ÐU ]M]E}EuU M}]uFJr Z))˃tdus}fx}]9]u@@@ ]u}]]9Ʌxō41Z)ˉJr x@@ f]x]}9}u|x]9]l+]f}9}T}9느U ME ]EuU }]MuJz )ωu9]}},@@@ ]u}]f~]J4MrJ f]9]rU]] uuF$9X F@@- \$\$4$]u]É$ t$P K4$\UE, 雏UEPr {UEPr [UEPr ;US]Cx, t$, []ÐUS]Cx, t$, ][]ΎUS]Cx, t$衎, []ÐUS]C(t$wC t$htE[]Ut&[]ÐUWVS,E ]M$ufPƅt;H~P u9t;N}0 $t&UT$D$$ؑ,[^_]t&t$$,[^_]t& $UT$D$$荑,[^_]$ UWVS8{ɍzыU)s_n]t&E$0视U )‰D$ T$$EP D$4$7UE1)Ѓ)00PB ൃB ED$<$,Dž$RDuE+Et^)ËU E$Dž09 Dž4Dž86 4$HE܉$E9 ƅ$[^_]Ðt& $EP둍&00PB ൃ@B ;888f00PB ൃB É<$ $~$趄UÉ$0߄ɉÉ4$3vU1ɉWV'SE }]9tB0ʃy719uȺ'i)э'{[)~+ &t9rs)ɍZٍt&9t9st[^_]Ðt&[^_]ÐU8U uu}}] @<)ȃN@t )ȉA@8)9v'+<UD$8$2@U<8F@@F]u}]Ít&FhUVSu ]F8 D$C$zF Cw C t$R F} C} CFCFC[^]ÉƉ$4$艂Ɖ$z4$wD$ &UVSu$ }(7 ÍFD$C$yF p* Cw C t$R F* C* C* CFCFCC[^]ÉƉ$~$.x4$Ɓp* Ɖ$vސUWVS<}} E @ Ẽ}E̋@ EЃ}tEЋ@ Eԃ}=Eԋ@ E؃}E؋@ EE܋@ E@ EtdfX u 2&C <$D$OsC$1$IwuՋEX$E$)wt]랋EX$E$wt ]hE܋X$ÀE܉$vt]/E؋X$蛀E؉$v]EԋX$wEԉ$v]EЋX$SEЉ$hv]E̋X$/Ẻ$Dv]KE X$ E $ v] <[^_]ÃD$ &US$]C H* Cw t$Rp* $,]$[]ut'p* $EUUEt$3$y$yǐUS$]C H* Cw t$Rp* ]$[]~t'p* $EU~UEt$~$Sy$KyǐD$ &US$]C H* Cw t$Rp* ]$[]~t'p* $EU}UEt$+~$x$xǐU]]uu C;Ct61҅tVPSS~tCC$]u]Ívt$D$$ ӐUWVSLEx)ivzM q)iɫvsEыI9ˉMIjUUEE11EE}9]9Mtn+}؉}܉+}9}܉}|YEċPF))9tN}ċM9Mt;M9M9| u%~t}M <$L$\U B G vL[^_]ËMĀyuO~tOω렍v};>MĀytd~tƃE }ЃE 9}iMċ't&~tЍMI9ˉM ~t&f됍t&} E|$$G UB #}EEE11EEUWVSLEx)ivzM q)iɫvsEыI9ىMIjUUEE11EE}9]9Mtn+}؉}܉+}9}܉}|YEċPF))9tN}ċM9Mt;M9M9| u%~t}M <$L$ U B G vL[^_]ËMĀyuO~tOω렍v};>MĀytd~tƃE }ЃE 9}iMċ't&~tЍMI9ىM ~t&f됍t&} E|$$1G UB #}EEE11EED$ &U($ ]uu}u(7 ÍFD$C$pF p* Cw C t$R F* C* C* CFCFCD$RD$@) $vƉ׉$ut4$bxp* Ɖ׉$xrD$'D$ &US$]C Cw H* Cw t$Rp* $w]$[]8nt'p* $EUwUEt$w$Dr$sL@@Eu`KPKP@MtNMԋLE+KD;PuM 1ɅtUMNSLLUԃLUԋKHEЃ9ʉGỦSLuԉU8Vuv9CL 8uu3MЉD$ẺM؉$,E܋F;F  1ɅtM܋U؉HNNv9utIA9tBP;Pr:uE̍A&M9EԉPP HPH t H9sۉuCLSHEuECLE+CDD$ $D$1<&S@ڋ D$ЄCLSH]t&<t&{dUāҋM:S HS &Sl+Kh;z@J99Ɖvt:) t&+SDD$ $T$)1_fr<2trփ>(~'CL+CDD$$D$1CLGD$ D$$EuE<)ȉEԋ@)ȃ@)ȋSHC`CLCLGD$ D$$EuE<)ȉEԋ@)ȃ@)ȋSHC`CLCLGD$ D$$.EuE<)ȉEԋ@)ȃ@)ȋSHC`CL4EԋũCLD$ CH4$D$CLD$rSP)…GUD$ D$$UPD$ D$$jRPCL~D$ CHD$CLD$Ẻ$AKsL MEԀ|c+CDD$$D$1EԋSHG9ЉCLuu̍KLT$L$M4$D$ aMƋCLRX<'1u 't9EԉCL>uu $D$]D$D$$EUKLP<'8QKHSL9/C2|0ZB9ȉCL EuEEEԋŨCLD$ CH$D$CLD$6sLS| +KDD$$L$1EE-EԋUԋũCLR6UԋM1Ҁ|nv+KDD$$L$1fD$ D$$Uā@<>+KDD$ $L$g1CLt&.CL+CDD$$D$11gE̍&+CDD$$D$ 1?DVD$D$$pCSL|BSHCL9%fsLkLt& sLcGECLD$ D$$Eԋ<)UD$D$${Eu@<)ȃ@)ȋSHC`CLSHpsL9։Ux&%uԍHMЉKL9SŰ P|M}}̉Mt&;EԉCLz7|uE}UЉE$L$ډUD$D$$UB!ЉAiSPuԋCH9usLEtZỦuԋ V|]UủUԐt&9EЉCLt(|uUԋMUD$ $<[EGE-MԉQ:C tC CdEExEԃ;CHCLMԀy>sHKL9ΉutUԋERUԋuԉʀ|0uMԃ9UЉSL[E̋EM|u܋MԉuT$ $iUD$ D$$U@uD$ L$t$C$,Kҋ1M̉uԀ|ep;sHsLPMLM}%t }5wFCLSHKHE"" 9uuЉ΃EUԉCL u9ʉuD$D$$@'M؉D$FL$$艷NCLEMЉP;SHSLFM@1D<%t<5,B MHL$M$L$sLu!2$ DUWVSL]KLA;CHCL;Wց@EEuaSPSPGUЉUtJ+CDEEL;P81ɅtMUHL;LMЉM̋@<)ЃS@t )ЉB;@8)ƒw!+<D$8$@P@C@SMJHJ <)ʉUԋS`U@)ʃ@)KdS`pCTCdMCTEȍ&CL;CHtC<S@ډ$Єuߋ;@+<9C`Cl+ShtIP9U}A<Cl@)ȃ@))ЉDCl+ShB;{d%:C wtC EMljCTCL;CHKdBMоt2GHLu)ʃ9Y+SDT<CL@)ЃS@t )ЉB;@8)ƒw!+<D$8$@P@C@CŰMPRK\P EC`w CL[^_]Ít&P9U;mt&S@ڋ D Cl+ShU;PyGCL+CDD$$D$J1낍sI6|O$D[&uЃfv@<)Ѓ‹C@t)‰P;@8)ƒ w!+< D$8$蠰@P @C@S%;B+CDD$$D$e1PUHD$<$T$ݳEЋ;E$ ?UWVSE09u\t&4$`=;}tK^ >tCuً$PCu‹$P 4$=;}ut&[^_]É$FUWVS\] TED$ D$ED$U$EԋHDM̉MЅ MԋUԋY Uȉ]t&PEЅt7MЋpV9vы}9(u+uyƋP uɋ]9][Eȋ{EЋG;EЉJu9(uu)ƅ}: |;]t%\$U$3=Ee[^_]ED$ D$ML$]$u؍]܉E܉\$4$t$$~BE؃ =: ZE܋pHu6E+EM :  : 9]Ee[^_]QxY$IEE܋pxƅx $2EE܍UD$ T$t$$wUU뗐t&]M40t&뿍ED$ MD$D$E$;UL]ԃ ]E$ELy'vSL]u}]Á$# vMčBEԉCL9>B|uqt&9UĉЉSL:|9uPSL}D$ EԃD$<$D$E@U<$:{L}ԋEq;B;EĉCLqz|9M)z CLD$ L$D$4$ܹx CL+CDD$$D$1f ;SHSLȃ(f s c S C3#}čEUD$ D$)׃T$4$D$ ~{LCLD$|$C$跸…M+KDD$$L$1&|+SDD$$T$i1ef;UĉSLt}čCLD$ D$4$|$'SLyP+SDD$ $T$1fCL+CDD$$D$1EЉ<$8E;SHtK1 |u<$;E뾉É<$H8$?UVS0]CLED$ED$ D$C$^u*$"$D$0[^]Í&3Vt6~ KPr/CL+CH$D$D$ 01[^]Ít&t돐U<CSL@)ʃK@t )ʉQ3@8)уw'+<T$8$E肧@EJS@BSB @B 0[^]UH]]uu }CFLN9UT t` t#FLCEԈ؋u]}]fVHUԍP9UԉVLP|FLFL뻍Uz$u_P;VHVLtH| M+VDD$ 4$T$vvBFLCUԈT&PEԈVL<&P9UԉUЉVLP9UԉVLt:@|t9UԉVLt$9|uB9EԉFLt 9B| tAE+FDD$4$D$fFL4$jC&BFL}T$ UЉT$<$D$E@u7E+FDD$4$D$O<$4GfFLEwĉ<$7Exv<$7E@C봍vE"C룉É<$4$;UWVS]ËsF;EvM}9(u+uyŋC ]u‹U9]]tp{G9ЉEvыu9(u+Ex@UM0, AE : 9;E}:&UȍMT$ $(UEMED$ \$T$ $誼EEE =: u^UȉUi])$I &E$I |I  : G*D$$3 D$|I $%t\P~6EȉEǍE$ )Eȉ$(M؉ $(<$K0UT$$)MȉMPJH롉빹PUT$$(B%ED$$(BED$$t(tmBED$$G(tYBPED$$(PU߉T$$&}lj4$^+UЉ$S&PPJH뿉lj$9&ǍvЍ느UVS]H`, t$#<$#stFt)Cx, t$#, [^]Í&4$PFu4$P 붉Ɖ$4$,UVS]H`, t$ #<$"stFt)Cx, t$", [^]Í&4$PFu4$P 붉Ɖ$e4$-,UVS]H`, t$]"<$O"stFt)Cx, t$$", ][^]"4$PFu4$P 붉Ɖ$赒4$}+UWVSlE ]t phE]D$D$! $%}؉\$<$)E =: 2E܍uE(7 D$4$"EEEEEH* E\* $ '(7 Í@t$$`"E1p* Cw C t $R uȋE* C* C* CEЉCEԉCC t$Rs t4$P EEH* EĐw CEЉCEԉCEȅt$REEp* $)D$RD$@) $(&C+C UC,EME ES0uEEs$P$1 щUEEUMU$D$L$ T$(;UEC뚐t&OUWVSL]<@3  D3 ]+] U)Uԋ}ԉM̉]ЅuԋE<_);U~UЍ9t=M 8|C!t& 8|19u9Uu t4uԐ릍U t&፶m)uԉ}̋}ԅx]9]t;CM+M )9t1`/ L[^_]Ëu 9u-/ ٍED$ D$ED$U $аEԋ0,MȉMЅMԋUԋY Ủ]ĉt&PEЅt7MĉЋpV9vы}9(u+uąyƋP uɋ]9]tRE̋{O9щMwrKLA;CHCL-CQ| uD<t-<KLD$D$ $1KLD$D$ $ԙ1É4$#${U(uu]}t2^tCt*u]u}]]u}]Ív$P{uċ$P 뺐U : WVSl} ]EXq2MD$ )L$RD$$ : T$H$pPƅx $W t$D$$QHs$P‰UċPx $W u܋}ċ |$ D$T$4$Q t$$LE܃ =: ,BJufEuЉD$ D$D$4$t$$EЃ =: e[^_]vtwBJtqx $B|u5PB9D$ D$D$$aBfBe[^_]W uԋ UD$T$ G 4$D$Q t$$5Eԃ =: 1PHU1҃}uGt&;us,Qx$!PHU0:\uҋ@E;uU)D$ T$t$$oW u؋ UD$T$ G 4$D$Q t$$xE؃ =: \R9*)D$ T$D$$pmP‰U$7k PUT$$s4$"<$ %tQP>UT$$&*t/PTUT$$@PJH묋PJHmPJHAlj$<$$7k $7k ԉ4$Uʺt7PUT$$k&PJHƐUWVSL} E9}EmMU]qR Utu}ԉE&E}{uEv9t 8t&;uMEE9AwU}UEH sME : A zEЍMD$ D$: D$D$Mԉ $bE1@ f;uUBt!\$Mԉ $y;u{s+UB UzUEԉ$wEe[^_]Ít&M}tȋR$L$P8ti;tvut& 9u@L$$R8t_ExUEe[^_]ËPUE : UUЍEfEu؈UUD$ T$Mȋ4$D$t$Eԉ$4$aU1Rtet&;UBExU;ust&>uM^9y EHFUԉ$ M]ЋA\$D$Eȉ$蘃 MAEx]+MȋMЋPL$$PE?fu :ft$Eԉ$!At&t&u:vf\$Mԉ $;uU9r:H+vUzl;uu[D$\$Eȉ$菂UzU0UЍEfEu܈UUD$ T$Mȋ4$D$EE袯UWt$Uԉ$4$W `E4$Ít&; Mԉ $0 $݉Ít&㐐UWVSlU Eu]҉ẺF tM EvIEufl[^_]$# ut U t܀;Sރ1t& ׃)9r}E)uȋUU҉UtY1҈ʊuɉMEċE43҉UԋU MԋM U1҉M̋M 9rE̋UЉEEE)U9UtM&u l[^_]Åt C C MU :l[^_]ËQ|$\$4$]EM 9ۉM t S S S E|$MD$L$ U B4$D$RIE=ỦM A }wSM̸}w7M̸t%E @w11  V F|$U\$T$ M A4$D$sE 8tUȅt|$U\$T$ M A4$D$5p‰M D$M\$L$ U B4$D$?1҉߀ ӈMԍ&F(D$ÉD$F$~tE uyQJEۉM  U J 1=8u AIEۉM ~y1ҍM߀ ӉMEЈ]F MD$D$ U EL$$T$;EtUuۉM  M 1&Ѐ|t=u‰M D$M\$L$ U B4$D$q1҉߀ ӈMԐF(D$ÉD$F$}uE udt& 1&D t =uϋ]/E )1҉߉ӈMЍ&Fˋ@L$$RU |tM u1҉]ԉωӈEt&Fˋ@L$$R8uԋEM ȉi31 9r E @wV F tЃ|$\$4$蕁M|$\$4$ofc{fIE1UWVS|u] EEF EEt&;  CE1ɐt&w$$ fx@u}fHvPwɉKbPz!u@@뼍t&@볍vzvuPzt;Cxu@@@ @$[]]&EЋM̉)P@ZFF F C UЉED$|$ D$C4$D$UFF D$|$ T$C4$D$bt dt&SJI;Ku MJt&uø"fCF [F ]܈E؋E;E1҅tU؋M܉HUЃUЋ[x};xL}?},;=fы@@@@EɈF t $|[^_]Ë@$u PtЃxP u9t y$sU}T$D$<$ED$ D$|$$`U$fbU$;`E =: FPe}|$$QU؍}̉T$D$<$qm8}L$<$6A$s}|$}D$<$zy}t#}QUzt 3CUV -ËE̅t$3$É<$aِt&҉ÍE$^ދPJHUWVS3UVUԅ:S tUۈS F<[^_]Í&Jx3zfC< C@@<)ƒC@t)‰P3@8)ƒ8P@C@CKH@RP CL9S@ڋ D$ЄCLKH]t&CPUF(E܉U ]E<[^_]t&Sl+KhJFSL+SDD$$T$E3Eqt&C< C@M܋E&CL+CDE ]E<[^_]類+<D$8$uj@fE(EE 뮋JUWVS]3@<)ЃS@t )ЉB3@8)ƒw!+< D$8$i@P @C@U CJ:Eu)FB RMM U)V Q,+Q(V΋UIJv ru3Ft>S0U!9Uu S4!9S4g M#M;Mv K4U!9f M QMQM QMQ<;}uvG9u~@8)9v3+<8 $<8|$E|h|E@{ @StR D$$QFi{ StȋRL$$PGG9uIU JB M;EtuEuSvEMEUֈEՉEӍEEMtE׍UՉD$ MȉT$C $D$菚uȍẺt$$Eȃ =:  }EtEԉD$ E҉D$Cuċ4$D$>t$M $Eľ:  9 E̋P}GwutE̋HPUMtu9v9ɉ‰Ήщ(Ʌu M+tMt;TU@8)9UM@x…=Ẻ$ ŰzJׅxỦ$U)׉|$T$4$E̋@E̋xEPM $EPH…ɉUxM $EU)t>T$D$4$E@E =: E̺:  9EE9EEU{ @ECrbMMEyE : E : @ hn: : xM̉ $Ũ ED$ D$D$D$Ẻ$.ẺM@ t$D$ D$ $D$E@E HxM $;E UD$ D$T$D$u4$E@ |$D$ D$4$D$h}wOGMtfM@L$$R{ ECy@t$$R{ ƋEEUxCTʋ@L$$R{ EC0@|$$Rt&+<u8$t$mc@E&P‰ULvxE PxE$E UD$ D$T$D$U$t&ut$ ED$D$E$UM̉T$ $U : But$$fEuD$ D$D$4$.t$U$E:  9i}Gwutt&EuD$ D$D$4$Ẻt$$?U:  9BED$$pvE P,p(U9MMfEUEMEFEӍEԉD$ T$C $D$_ED$U$E =: %EPHU@щU8)9U\MM@H…pE$MUJBхMxE$0UET$<$)ЉD$(E@E =: 9uE : ~FD$ t$CD$E$QUT$M $|E =: PUډT$$fU K8JK0MM#M;MUM S8QE+E<Ce[^_]Í&+<}8$|$l_E@Ewv@ЉEv: ;];])e1[^_]Í&: tA΍EىD$ $1RPU܉T$$PUމT$$|PUT$$KfPU؉T$$PUT$$ PUۉT$$P}OWUt~UȉÉ$2u4$'Ẻ$$t4$t&̸t/MAE߉D$E$Ẽ EuFPVθtXUBE݉D$u4$1ED$4$ugE̍uE ED$4$VgEE ED$4$?gfE΍uE;ED$4$gD$. uD$. C$ EEEuE)ED$4$fEE]ED$4$fEE}ED$4$f3vEuE(ED$4$~fEE[ED$4$gfEE{ED$4$PfvEԍuE'ED$4$.fEE,ED$4$fEE#ED$4$fvEڍuE"ED$4$eEE'ED$4$eEE`ED$4$eCvC,uEE.D$t$$<-&CL+CDD$$D$f+CD$1D$D$GÉ4$K$0UWVS|]SLB;CHECLEuEEEEEEEEEEEEEEU#t$$豦CL9CHSU8|: v tI uHMKLxT: ECLt$$A뎍&9Ep}CL:}D$|$$7Kt$$ʿ1-v9Et& E9CHECLEt&1ۋU܅t$Ut$Ut$|[^_]Í&D$EL$$ؽtT EЋCLECL&UMD$T$ $蝽t) EԋCLECLVt&SLUt&CLE}D$|$$^CL+CDD$ $D$}+CD$1D$D$q} É<$2H$ZUtUWVSl]6҉ t ǀC ǃ SC4C8ECCC0EÈC0u#C$EEt @(EE{ỦUEO7})iuEċE9Ek9t EfỦUЉPUԈP 9uU9Ut%ẺD$ E+EĉL$<$D$蕟{MH E@$C G C$pUuFUظFuFFGu1ҋCM؅tFx HP tGbu܅tFxutFC0S$ 1҅tQD$$;C${CECF@,C,C;B BBGB)iv5$ RPGD  )i9r֋CC${Fur{Et8C1 t2KCCF;BBAACB BA{FCu4C{FCu(1 $p3ǃ l[^_]Ít& rB)i~qv;suYQ;C u뛐MI9EĉOM) iɫ*? I vŨ U9ȉPUԈPus;t$<$g`F G C014$PF4$P 4$PF4$P <$vPG<$P st&4$vPFj4$P ]t&щU11EƉ4$?D$$IuvƍE܉$)HE$Hʼnƍ $m1ǃ 4$KUUWVS<]SL;SHt\;Gu@KMԋ1 E|u GSLEuu|~EtEECRap;‹<)ʉΉU䋗@)ʃ1@t )‰Ps;+<8D$ M<$ L$C@ U ;ƀU<<Us@)ȃ)ʃ@t )V;@8)у w'+< T$8$EB@E܍J @SBS +<)Ήr3@<)ʃ@))‰T}uG<[^_]Í&3}+SD$D$ T$u<1[^_]Ít&;1@<)ЃS@t )ЉBs;+<8D$E<$D$B@;@O<H @1<S)ȃҍ@t )ЉBs;+<8D$ E<$ D$}A@ <@s<)@)‰P;@<)ЃS@t )ЉB;@8)ƒP@C@C@RP <[^_]Ð;S\<Uvp |0 p@<)@)‰P3@8)ƒ w!+< D$8$?@P C@@CH ;@C<)Ήu+<D$8$U?@fSLEUWVS<]E EߋCL;CHS,T$D$C$xDtSLCH9ЉSLXˍt&CLSH9BKLMT$D$ L$C$MSLƋCH9t$C,D$D$C$DCL9CH{uUʋ}Ԁ| AUӉC,҉T$ $D$Ct!KLCHQ9ЉSLQKɍt&SLCH9r}{|9uSLEt$$D$<[^_]ÍvSLCH9ЉSL#t&+CDD$ $D$q1뺐t&{| u1;SHSLe+SDD$ $T$Kq1yt&+SD$D$ T$)q<1[^_]Í&;CHCLtuS,T$<$D$gBtSLCH9ЉSLtKЋ{ύt&CLSH9t6T$D$ ML$C$K ‹CL;CHUu'+CD$D$ D$p<1[^_]K‰MUWVSUBD$Ѓ$QU29u]t&4$;}tK^ >tCuً$PCu‹$P 4$B;}ut&[^_]ÉËE$裋$$UUWVSL]CCC `, $}ЉƍE$}<$uUET$|$$IU$qX(<${]E$RsC$|p C@@@- t$t$<$>C C$ǃ@ǃ<ǃ8ǃHǃLǃP* e[^_]ÉEĉ$8Eĉ$d$4$/Eĉ<$EčU$Es4$EՉEĐE뜐UWVSl$X{@@@ `, $RuǍE܉$4$U܍M؉T$t$ $GE؃$&4$U܉$K{CM$@@@- x CE|$|$$1=C C$ǃ@ǃ<ǃ8ǃHǃLǃP* ]E$KX }@@- EЍẺ\$\$$XsLD$D$$=0sL3@<)ЃS@t )ЉB3@8)ƒ w!+< D$8$?*@P C@@SH1 uBsLD$D$$"=X{HusL fsLsL9t+|  uN9KLN| /uԍFCL9u4uut&@<)@t )O@8)σ w'+< L$8 $U)U@y @KA{{ SGtM@L$$RwwG ;uf}{w'?<UM@98u&+ML$8 $UO(U@E+}<{ @S{Ot&PEE$D$UMRMwwD G1sLD$D$ $;HsLD$D$ $: M9щUSLt828|7u}WSL|$U$T$t&M+KDD$$L$>[1&CL+CDD$$D$[1&+{DD$$|$Z1jfCL+CDD$$D$Z1&CL+CDD$$D$Z1&KH1V;SHSLNEMECLD$D$ $9xRP E}CL;CHtS |+CDD$$D$Z1|ދ{LCH}9ljEt~C 8|tm&;USLt 8 |u T$} $|$NjCLEa+SDD$$T$Y1CLU묉É4$+$$S␐US]SCL |v][]&T$`( t&+CHD$ $D$X1[]Ð@t][][[v][]vCLD$ D$$7J1 u҃P돍;CDwCLD$D$$]t&;CDGCLD$D$$-t&;CDCLD$D$$t&CL@% $D$D$6[]ÍCL@% 뾍vCLD$$*~t&][]3nv][]svR KH9tCL u #f t u؍⍶D$D$ $V1UWVSlE ]t PhE]D$D$! $}؉\$<$E =: 2E܍uE(7 D$4$ EEEEEH* E\* $ (7 Í@t$$E1p* Cw C t $R uȋE* C* C* CEЉCEԉCC t$Rs t4$P EEH* EĐw CEЉCEԉCEȅt$REEp* $'D$RD$@) $&C+C UC,EME ES0uEEs$P$1 щUEEUMU$D$L$ T$*;UECA$Xͨ@@@ `, GCGCt@C C$ǃ@ǃ<ǃ8ǃHǃLǃP* ]E$6X @@- EԍEЉ\$\$$]ԋEЅtC}E]tG]ԅtCE\$D$EEEED$ EEEED$E EEED$$CEąt$$E^UEۉF]tCt9Ĭ[^_]Ít&$PC,$P $P{u$P 뫍t&<$PG<$P $X苦É$aE؉\$$]܋E؅tC}E]{Gt ]dt&<$PGu݋<$P ӉƉ$E$"4$zƍE܉$ މ$$P 6ʼn뼋Uĉƅt$蘠멉ƍEԉ$뚐UD$$3 D$I $* >ÍU(]]uuD$D$I $=I w-I I 5I $1]u]Í&4$ݍU(]]uD$D$I $I t(ƃ-I I $]u]Ív$蜤ىƉ$4$US]x1 $][];v'UEx1 黠v'UEx1 雠v'US]E $D$觞Ex1 CEC []Ð&'US]E $D$gEx1 CEC []Ð&'U8}} ]]u<$UuT$D$4$Mt$$E =: ux1 {C ]u}]út3P΍UT$$c뽉É4$$oPJHU8}} ]]u<$UuT$D$4$蝡t$$QE =: ux1 {C ]u}]út3P΍UT$$賟뽉É4$g$迦PJHUVSP]uEԸ8 4$CD$Ɖ$롉$*뱉9Ɖ$蕡낍v봍&'UVS@EuEܸ8 4$D$EEEEEܨ} E} $ 8 Í@t$$蟛E1Cw C t $R uE} C~ C~ CECECC t$Rs t4$P EEܨ} Ew CECECEt$RE܉$SD$0LD$| $kƍE܉$N4$&E܉Uԉ$ Uԃ4$ƋC Cw } Cw t$R$̚$E܉$붃t'Uԉ$襚Uԃuщ4$5u9$!4$Ɖ$o롉$ƍv뮉<Ɖ$m|뱍UhE ]u}cXE]D$D$ 1 $n}؉\$<$菢E =: =E܍uE(7 D$4$uEEEEE2 E2 $ o(7 Í@t$$(E1Cw C t $R uȋE3 C$3 C43 CEЉCEԉCC t$Rs t4$P EE2 EĐw CEЉCEԉCEȅt$RE$蜠D$P2 D$1 $t&]u}]ÉƉ<$艕4$衠t3PUT$$YƍE$臝봋PJHʉ뭉Ɖ$롉Ɖ$`$hE$mwƉ$ޟ܃`軚ƋC Cw 2 Cw t$R$螟뜃tMEU$臟U 4$St,U$aUU4$-l$ $량fUS]t$褕u[]ÐD$ &U($(]uu}8 ÍFD$C$蘖Fx1 Cw CF C FCt$R F4 C4 C$4 CFCF C D$0 D$`3 $诜Ɖ׉$蓛t4$fƉ׉$D$ &U($ ]uu}(7 ÍFD$C$踕F Cw C t$R F3 C$3 C43 CFCFCD$P2 D$1 $Ɖ׉$Śt4$蘝Ɖ׉$L5D$ &UVSu$ ٘(7 ÍFD$C$F Cw C t$R F3 C$3 C43 CFCFCC[^]ÉƉ$ $D4$ܜƉ$蒜D$ &US$]C 2 Cw t$R]$[]Mt!$EU:UEt$g$$͐D$ &US$]Ch4 Cw t$Rx1 $ ]$[]_t!$EU;rҺ: 97};3MuAt$$RE}ԉD$D$! <$迊Eԍ]؉D$$U܉T$$辐}ȉ\$<$$跈<$<$觍Mԉ $蜈ƍ}܉<$芈4$}ԉƉ<$u4$]}U|$B$訐蓆t-PUT$$k/눋PJHЉƍEЉ$뎉늍&tkPUT$$tIPUT$$sƉ<$蒌}ԉ<$臇PJH뒋PJH봉Ɖ$bƍt&čUI EP]&U]ÍU(uu]]}} $tB5I $Ή1҅us؋u]}]f苂ߍ&I I Sˍ&'U5 ]]ut(U I I S؋u]]t&D$$ x 5 멐u5 ffI C뙍USt]ED$E $D$芃u&I CI EC؃t[]&kCI C؃t[]&'USt]ED$E $D$ u^E%=t'I CC C؃t[]I UȉCI EĉS C؃t[]v賀CC I C؃t[] UED$E]]u}$D$?ƍ(D$E $D$uBu>(,3U3E tP1I CSI ؋u]}]=I tt{C1t&EU3U3E uTX3U3E up;E{'UVSp]EuD$E $D$Ft2MI I Vp[^]I I VE%=@tq=tz=`= ==p[^]mI Vp[^]vYt&It&9t&)t&t&UWVS] u$聅D$Nj$]EED$$D$U<D$ET$$ EUD$|$$Y~"1)D$7D$E$ykËE$覄U É$薄xYۋ5I xU1Urt&3}UI Bt<$HEČ[^_]9mI5I ||U$EUI B뢅t<$$0UE]]u5I D$E $51҅tz|؉s]u]t&UE]]u5I D$E $1҅t*|؉s]u]t&UHuu ]]}D$$y|u%I CCI ؋u]}]{8EtI ;CCƉEUEԉT$t$$}uΡI CCI 돐UE ]]u5I $1҅t3{؉s]u]&'Uuu E]]}D$$D$|t#zI C؋u]}]E=I EEEED$$%1҅u{z{밍v'U]]u}CC CCCCECD$E $zu{I MuI EΉSʉEEUUCS MEʉEEUUCSME<C{؋u]}]t&yI CCCSCCC fUxED$E$D$n}1uE%=Ít&UVSp]EuD$E $D$&}t2xI I Vp[^]I I VE%==@==`f= t&=t&=p[^]&MI Vp[^]v9t&)t&t& t&t&t&U I  I  I w I  I I  I I  I Í&'UWVS~É4$vPJHÍ&Uuu ]]}$zt=ur8ƒtlUED$$D$;tUt1u%I I S؋u]}]t&t֡I ;Cڍ&f'뎍v'Uuu x]]}D$$D$su@E%=@tIE EҡI SCI ؋u]}]fsqI CSՀ=I tE : }<$D$'E؉|$$E؋u܉tI ptFE =: p19t>v$I Lrm$I I I uD$$3 D$I $pN Hq,v4$PFc4$P Vt8PNUT$$t:É<$At${PJHŐUE]uXtCt]u]Í&$Psu݋]u]@ ]UUHt&8 t!D$D$/$rɃÐ1Ít&U(I KI AI 7I D$'D$`= $I I ED$ yD$$3 D$I $oED$D$= $I tD$$3 D$I $roÉ$(zU1U IufI HD$D$$L$ sɃUS]Pt-8 t(I PD$D$$T$ qt v1[]ËPD< t<.t፴&t&tD$D= $s빍&US]Hu 1[]Ðt&D$E= $su []ÐD$D= $`st$ft$t<.t<-fU]]uPu1]u]Ít&D$E= $ru|D$E= $rtD$D= $rtD$D$.$doƸtFD$D$.$Aop;pbD$D= $hrl$8$(<.<-7US]D$E= $ru[]Í&D$D= $qtڋHu 1[]ÍvD$E= $qu$D$D$.$Ln뗍t&D$D= $qtȉ$4ft$t<.t<-u1뀐U= ]ÍU= ]ÍUSJ ]MD$$L$R ؋]fUEA ]fUEA ]fU=J t J f$J \lt J h@ $J oD$$3 D$ J $`S fk J  U=8J t @J f$8J kt@J @ $8J boD$$3 D$@J $PS j@J Ð&'USd]eE1=(J u$(J vkuJED$ED$@$mttUT$D$$oUe3ued[]vED$D$4 $0J }o$(J nD$$3 D$0J $%jnD$0J $liq$(J ;t$t$tv'UEA jv'UEA jv'USE]=vJ Cf؋]&$= D$$ D$$ D$}$ D$s$ D$r$ D$q$ hD$o$ PD$n$ 8D$k$h  D$j$P D$i$8 D$h$ D$g$ D$f$ D$e$ D$d$ xD$c$ `D$b$ HD$a$x 0D$_$` D$]$H D$\$0 D$[$ D$Z$ D$Y$D$X$D$T$pD$K$XD$J$@D$G$p(D$C$XD$?$@D$>$(D$=$D$<$D$+$D$*$D$($hD$'$PD$&$8D$%$h D$$$PD$#$8D$"$ D$!$D$ $D$$D$$xD$$`D$$HD$$x0D$$`D$$HD$$0D$$D$$D$$D$$D$$pD$$XD$$@D$$p(D$$XD$ $@D$ $(D$ $D$ $D$ $D$$D$$hD$$PD$$8D$$h D$$PD$$8D$$ D$$U=8J ta=J J @J JJ  J J  J =8J  J  J tkJ @J I I @J Ív$8J bt@J @ $8J eD$$3 D$@J $PS aX$8J ]+)[">]Optional functionality won't be copied: to the list of dependencies to extract to copy this functionality.^[[:blank:]]*#[[:blank:]]*define[[:blank:]]+(?:BOOST_PP_FILENAME|BOOST_PP_ITERATION_PARAMS|BOOST_PP_INDIRECT_SELF)[^\n]+?["<]([^">]+)[">]CAUTION: Boost.Preprocessor iterated file BOOST_PP_STRINGIZE(boost/mpl/aux_/preprocessed/AUX_PREPROCESSED_HEADER)BOOST_PP_STRINGIZE(boost/mpl/list/AUX778076_HEADER)BOOST_PP_STRINGIZE(boost/mpl/list/AUX778076_LIST_C_HEADER)BOOST_PP_STRINGIZE(boost/mpl/list/AUX778076_LIST_HEADER)BOOST_PP_STRINGIZE(boost/mpl/map/aux_/preprocessed/AUX778076_HEADER)BOOST_PP_STRINGIZE(boost/mpl/map/AUX778076_MAP_HEADER)BOOST_PP_STRINGIZE(boost/mpl/set/aux_/preprocessed/AUX778076_HEADER)BOOST_PP_STRINGIZE(boost/mpl/set/AUX778076_SET_HEADER)BOOST_PP_STRINGIZE(boost/mpl/set/AUX778076_SET_C_HEADER)BOOST_PP_STRINGIZE(boost/mpl/vector/AUX778076_VECTOR_HEADER)BOOST_PP_STRINGIZE(boost/mpl/vector/aux_/preprocessed/AUX778076_HEADER)BOOST_PP_STRINGIZE(boost/mpl/vector/AUX778076_DEQUE_HEADER)BOOST_PP_STRINGIZE(boost/mpl/vector/AUX778076_VECTOR_C_HEADER)^[[:blank:]]*#[[:blank:]]*include[[:blank:]]+([^"<][^ ]*?)[[:blank:]]*$CAUTION: don't know how to trace depenencies through macro: ^\s*int\s+(?:cpp_main|test_main|unit_test_main)boost/([^/]+/[^/]+)/(?!detail).*<(?:img[^>]*src=|link[^>]*href=)("[^"]+"|\w+)[^>]*>tools/build/v1/allyourbase.jamtools/build/v2/boost-build.jamboost/preprocessor/iterate.hppboost/preprocessor/slot/detailboost/preprocessor/slot/slot.hppboost/signals/signal_template.hppboost/mpl/aux_/include_preprocessed.hppboost/mpl/vector/aux_/preprocessedboost/mpl/vector/aux_/include_preprocessed.hppboost/mpl/set/aux_/preprocessedboost/mpl/set/aux_/include_preprocessed.hppboost/mpl/map/aux_/preprocessedboost/mpl/map/aux_/include_preprocessed.hppboost/mpl/list/aux_/preprocessedboost/mpl/list/aux_/include_preprocessed.hpplibs/graph/src/python/visitor.hppbasic_string::substrbasic_string::erasevector::_M_fill_insert: ", "boost::filesystem::existslibssrcbuildAdd the file Can't parse filename included by file boost does not exist.BOOST_USER_CONFIGBOOST_COMPILER_CONFIGBOOST_STDLIB_CONFIGBOOST_PLATFORM_CONFIGBOOST_PP_FILENAME_1BOOST_PP_ITERATION_PARAMS_1BOOST_PP_FILENAME_2BOOST_PP_ITERATION_PARAMS_2BOOST_PP_FILENAME_3BOOST_PP_ITERATION_PARAMS_3BOOST_PP_FILENAME_4BOOST_PP_ITERATION_PARAMS_4BOOST_PP_FILENAME_5BOOST_PP_ITERATION_PARAMS_5BOOST_PP_INDIRECT_SELFBOOST_PP_INCLUDE_SELF()BOOST_PP_ITERATEBOOST_PP_LOCAL_ITERATEBOOST_PP_ITERATE()BOOST_PP_LOCAL_ITERATE()BOOST_PP_ASSIGN_SLOT(1)BOOST_PP_ASSIGN_SLOT(2)BOOST_PP_ASSIGN_SLOT(3)BOOST_PP_ASSIGN_SLOT(4)BOOST_PP_ASSIGN_SLOT(5)BOOST_ABI_PREFIXBOOST_ABI_SUFFIXBOOST_REGEX_USER_CONFIGBGL_PYTHON_EVENTS_HEADER in file: testboost/([^\./]+)(?!detail).*./boost/configboost/config.hppJamrulestools/build/allyourbase.jamproject-root.jamboost-build.jamJamfile.v2boost/preprocessor/iterationboost/function/detailboost/function.hppboost/regex/user.hppboost/regex/config.hppboost/functionboost/mpl/listboost/mpl/list.hppboost/mpl/list_c.hppboost/mpl/vectorboost/mpl/vector.hppboost/mpl/deque.hppboost/mpl/vector_c.hppboost/mpl/mapboost/mpl/map.hppboost/mpl/setboost/mpl/set.hppboost/mpl/set_c.hppboost/mpl/aux_/preprocessedlibs/graph/src/pythonCAUTION: dependent file binbin-stageCVS.svnCVS/Entries.svn/entriesأXa8hhALq K@LN5boost6system12system_errorE8 ,q 7 tq JLp6J8 q r N5boost6detail17sp_counted_impl_pINS_35regex_token_iterator_implementationIPKccNS_12regex_traitsIcNS_16cpp_regex_traitsIcEEEEEEEE7  r N5boost6detail15sp_counted_baseEr `6LPp6P  p 0P7P70^`@@A0BB@CC`DDw`rgDPSi ^D  Ez`E@9v: :p::U:k;a@`r<<dt P8 t Lq N5boost10filesystem22basic_filesystem_errorINS0_10basic_pathISsNS0_11path_traitsEEEEEt JLp6J8 u r N5boost6detail17sp_counted_impl_pINS_10filesystem22basic_filesystem_errorINS2_10basic_pathISsNS2_11path_traitsEEEE5m_impEEEH9 u @v `v 0N5boost16exception_detail10clone_implINS0_19error_info_injectorINS_10filesystem22basic_filesystem_errorINS3_10basic_pathISsNS3_11path_traitsEEEEEEEEEH9 v dt w 7  w N5boost16exception_detail19error_info_injectorINS_10filesystem22basic_filesystem_errorINS2_10basic_pathISsNS2_11path_traitsEEEEEEE7 Gw N5boost16exception_detail10clone_baseEN5boost9exceptionE@v P@v @pw PPu p`@u `u P0pP`v PPP6M00_EFF@ GG`HHIIfhITh_J @0JplJ0P=zp===>U@>i?d`c0?0@y JMp6J8 y r N5boost6detail17sp_counted_impl_pINS_10filesystem6detail11dir_itr_impINS2_10basic_pathISsNS2_11path_traitsEEEEEEE.moreblanket-permission.txt([^(]+)\(toolsThe Boost path appears to have been incorrectly set: could not find boost/version.hpp in Destination path does not exist: CAUTION: Boost is no longer in CVS, cvs mode may not work anymore!!!|  PPPPPPPPPPPPP{ p0@P`p 18bcp_implementation8 { | 15bcp_application7 | D| 788p6088 `| r N5boost6detail17sp_counted_impl_pI15bcp_applicationEEH9 |  } `v N5boost16exception_detail10clone_implINS0_19error_info_injectorISt13runtime_errorEEEEH9 @} 7 w N5boost16exception_detail19error_info_injectorISt13runtime_errorEE } P8F } @8F| 0LKII|  LpK| IHL`KL~ ~ ~ ~ ~ `~ ~ >p\pp~ >`\9 ppp9 `@5 @Ppp5 `8  9 N5boost10filesystem14basic_ifstreamIcSt11char_traitsIcEEERPTPO77boost::filesystem::removeboost::filesystem::copy_fileCopying file: boost::filesystem::create_directoryCopying (and overwriting) file: .*\.(?:html?|css).*\.(?:c|cxx|cpp|h|hxx|hpp|inc|html?|css|mak|in)|(Jamfile|makefile|configure).*\.(?:c|cxx|h|hxx|inc|.?pp|yy?)vector::_M_range_checkvector::_M_insert_auxBad file name: p68  r N5boost6detail17sp_counted_impl_pIN8fileview14implementationEEE-h--help-v--versionbcp Apr 1 2010--list--list-short--report--cvs--svn--scan--bsl-convert--bsl-summary--unix-lines--boost=Usage: bcp --list [options] module-list bcp --list-short [options] module-list bcp --report [options] module-list html-file bcp [options] module-list output-path Options: --boost=path sets the location of the boost tree to path --scan treat the module list as a list of (possibly non-boost) files to scan for boost dependencies --cvs only copy files under cvs version control --unix-lines make sure that all copied files use Unix style line endings module-list: a list of boost files or library names to copy html-file: the name of a html file to which the report will be written output-path: the path to which files will be copied ^(?:A\s+)?D/([^/\n]+)/^\f([^\f]*)\n[[:blank:]]*([^\n]*)has-props.svn-baseprop-basedirCVS/Entries.Log^(?:A\s+)?/([^/\n]+)/[^/\n]*/[^/\n]*/[^k/\n]*(kb[^/\n]*)?/[^/\n]*svn:mime-type[[:blank:]]*(?:\n|\r|\r\n)[^\r\n]*(?:\n|\r|\r\n)[[:blank:]]*text/ `p6p8  r N5boost6detail17sp_counted_impl_pINS_35regex_token_iterator_implementationIN9__gnu_cxx17__normal_iteratorIPKcSsEEcNS_12regex_traitsIcNS_16cpp_regex_traitsIcEEEEEEEEp  Hh0* P 8   X! !   Python Software LicenseSGI Style LicenseOld style Boost license #1Old style Boost license #2Old style Boost license #3Old style Boost license #4Old style Boost license #5Boost.Pool licenseOld style Boost license #6Old style Boost license #7Old style Boost license #8Old style Boost license #9Old style Boost license #10Old style Boost license #11Old style Boost license #12Old style Boost license #13Old style Boost license #14Perforce Jam LicenseBSD Regex License(?4University of Toronto)GNU Parser LicencePublic Domain(?1:(?2: ))+@*P+@***@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@**@*@*@*@**@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*@*x*(^)?[^-(Copyright (c) Date Author

Distributed under the Boost Software License, Version 1.0. (See accompanying file LICENSE_1_0.txt or copy at http://www.boost.org/LICENSE_1_0.txt)

Boost Software License, Version 1.0distributed\W+under(\W+the)?[^"[:word:]]+Boost\W+Software\W+License\W+Version\W+1.0

Copyright (c) Date Author

Use, modification and distribution is subject to the Boost Software License, Version 1.0. (See accompanying file LICENSE_1_0.txt or copy at http://www.boost.org/LICENSE_1_0.txt)

Boost Software License, Version 1.0 (variant #1)Use\W+\modification\W+and\W+distribution(\W+is|\W+are)\W+subject\W+to(\W+the)?[^"[:word:]]+Boost\W+Software\W+License\W+Version\W+1.0

Copyright (c) Date Author

Subject to the Boost Software License, Version 1.0. (See accompanying file LICENSE_1_0.txt or copy at http://www.boost.org/LICENSE_1_0.txt)

Boost Software License, Version 1.0 (variant #2)(?!is)\w\w\W+subject\W+to(\W+the)?[^"[:word:]]+Boost\W+Software\W+License\W+Version\W+1.0

Copyright (c) 2001, 2002 Python Software Foundation;

All Rights Reserved

Copyright\W+(c)\W+2001\W+2002\W+Python\W+Software\W+Foundation\W+All\W+Rights\W+Reserved

Copyright (c) Date
Author

Permission to use, copy, modify, distribute and sell this software and its documentation for any purpose is hereby granted without fee, provided that the above copyright notice appear in all copies and that both that copyright notice and this permission notice appear in supporting documentation. Author makes no representations about the suitability of this software for any purpose. It is provided "as is" without express or implied warranty.

Permission\W+to\W+use\W+copy\W+modify\W+distribute\W+and\W+sell\W+this\W+software\W+and\W+its\W+documentation\W+for\W+any\W+purpose\W+is\W+hereby\W+granted\W+without\W+fee\W+provided\W+that\W+the\W+above\W+copyright\W+notice\W+appears?\W+in\W+all\W+copies\W+and\W+that\W+both\W+(the|that)\W+copyright\W+notice\W+and\W+this\W+permission\W+notice\W+appears?\W+in\W+supporting\W+documentation[^<>]{1, 100}\W+no\W+representations\W+(are\W+made\W+)?about\W+the\W+suitability\W+of\W+this\W+software\W+for\W+any\W+purpose\W+It\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty

Copyright (c) Date
Author

Permission to use, copy, modify, distribute and sell this software for any purpose is hereby granted without fee, provided that the above copyright notice appear in all copies and that both that copyright notice and this permission notice appears? in supporting documentation. Author makes no representations about the suitability of this software for any purpose. It is provided "as is" without express or implied warranty.

Permission\W+to\W+use\W+copy\W+modify\W+distribute\W+and\W+sell\W+this\W+software\W+for\W+any\W+purpose\W+is\W+hereby\W+granted\W+without\W+fee\W+provided\W+that\W+the\W+above\W+copyright\W+notice\W+appears?\W+in\W+all\W+copies\W+and\W+that\W+both\W+(the|that)\W+copyright\W+notice\W+and\W+this\W+permission\W+notice\W+appears?\W+in\W+supporting\W+documentation[^<>]{1, 100}\W+no\W+representations\W+(are\W+made\W+)?about\W+the\W+suitability\W+of\W+this\W+software\W+for\W+any\W+purpose\W+It\W+is\W+provided\W+as\W+is\W+without\W+express(ed)?\W+or\W+implied\W+warranty

Copyright (c) Date Author.

Permission to copy, use, modify, sell and distribute this software
is granted provided this copyright notice appears in all copies.
This software is provided "as is" without express or implied
warranty, and with no claim as to its suitability for any purpose.

Permission\W+to\W+copy\W+use\W+modify\W+sell\W+and\W+distribute\W+this\W+software\W+is\W+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+as\W+to\W+its\W+suitability\W+for\W+any\W+purpose

(C) Copyright Author Date. Permission to copy, use, modify, sell, and distribute this software is granted provided this copyright notice appears in all copies. This software is provided "as is" without express or implied warranty, and with no claim at to its suitability for any purpose.

Permission\W+to\W+copy\W+use[^"[:word:]]+modify\W+sell\W+and\W+distribute\W+this\W+software\W+is\W+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+at\W+to\W+its\W+suitability\W+for\W+any\W+purpose

Copyright (C) Date Author

Permission to copy, use, sell and distribute this software is granted provided this copyright notice appears in all copies. Permission to modify the code and to distribute modified code is granted provided this copyright notice appears in all copies, and a notice that the code was modified is included with the copyright notice.

This software is provided "as is" without express or implied warranty, and with no claim as to its suitability for any purpose.

Permission\W+to\W+copy\W+use\W+sell\W+and\W+distribute\W+this\W+software\W+is\W+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+Permission\W+to\W+modify\W+the\W+code\W+and\W+to\W+distribute\W+modified\W+code\W+is\W+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+and\W+a\W+notice\W+that\W+the\W+code\W+was\W+modified\W+is\W+included\W+with\W+the\W+copyright\W+notice\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+as\W+to\W+its\W+suitability\W+for\W+any\W+purpose

Copyright Date University of Notre Dame.
Authors: Andrew Lumsdaine, Lie-Quan Lee, Jeremy G. Siek

This file is part of the Boost Graph Library

You should have received a copy of the License Agreement for the Boost Graph Library along with the software; see the file LICENSE. If not, contact Office of Research, University of Notre Dame, Notre Dame, IN 46556.

Permission to modify the code and to distribute modified code is granted, provided the text of this NOTICE is retained, a notice that the code was modified is included with the above COPYRIGHT NOTICE and with the COPYRIGHT NOTICE in the LICENSE file, and that the LICENSE file is distributed with the modified code.

LICENSOR MAKES NO REPRESENTATIONS OR WARRANTIES, EXPRESS OR IMPLIED.
By way of example, but not limitation, Licensor MAKES NO REPRESENTATIONS OR WARRANTIES OF MERCHANTABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE OR THAT THE USE OF THE LICENSED SOFTWARE COMPONENTS OR DOCUMENTATION WILL NOT INFRINGE ANY PATENTS, COPYRIGHTS, TRADEMARKS OR OTHER RIGHTS.

Boost.Graph license (Notre Dame)This\W+file\W+is\W+part\W+of\W+the\W+(Boost\W+Graph|Generic\W+Graph\W+Component)\W+Library\W+You\W+should\W+have\W+received\W+a\W+copy\W+of\W+the\W+License\W+Agreement\W+for\W+the\W+(Boost|Generic)\W+Graph\W+(Component\W+)?Library\W+along\W+with\W+the\W+software;\W+see\W+the\W+file\W+LICENSE(\W+If\W+not\W+contact\W+Office\W+of\W+Research\W+University\W+of\W+Notre\W+Dame\W+Notre\W+Dame\W+IN\W+46556)?\W+Permission\W+to\W+modify\W+the\W+code\W+and\W+to\W+distribute(\W+modified|\W+the)\W+code\W+is\W+granted\W+provided\W+the\W+text\W+of\W+this\W+NOTICE\W+is\W+retained\W+a\W+notice\W+(that|if)\W+the\W+code\W+was\W+modified\W+is\W+included\W+with\W+the\W+above\W+COPYRIGHT\W+NOTICE\W+and\W+with\W+the\W+COPYRIGHT\W+NOTICE\W+in\W+the\W+LICENSE\W+file\W+and\W+that\W+the\W+LICENSE\W+file\W+is\W+distributed\W+with\W+the\W+modified\W+code\W+\W+LICENSOR\W+MAKES\W+NO\W+REPRESENTATIONS\W+OR\W+WARRANTIES\W+EXPRESS\W+OR\W+IMPLIED\W+By\W+way\W+of\W+example\W+but\W+not\W+limitation\W+Licensor\W+MAKES\W+NO\W+REPRESENTATIONS\W+OR\W+WARRANTIES\W+OF\W+MERCHANTABILITY\W+OR\W+FITNESS\W+FOR\W+ANY\W+PARTICULAR\W+PURPOSE\W+OR\W+THAT\W+THE\W+USE\W+OF\W+THE\W+LICENSED\W+SOFTWARE\W+COMPONENTS\W+OR\W+DOCUMENTATION\W+WILL\W+NOT\W+INFRINGE\W+ANY\W+PATENTS\W+COPYRIGHTS\W+TRADEMARKS\W+OR\W+OTHER\W+RIGHTS

Copyright Date Indiana University.
Authors: Andrew Lumsdaine, Lie-Quan Lee, Jeremy G. Siek

This file is part of the Boost Graph Library

You should have received a copy of the License Agreement for the Boost Graph Library along with the software; see the file LICENSE. If not, contact Office of Research, Indiana University, Bloomington,IN 47404.

Permission to modify the code and to distribute modified code is granted, provided the text of this NOTICE is retained, a notice that the code was modified is included with the above COPYRIGHT NOTICE and with the COPYRIGHT NOTICE in the LICENSE file, and that the LICENSE file is distributed with the modified code.

LICENSOR MAKES NO REPRESENTATIONS OR WARRANTIES, EXPRESS OR IMPLIED.
By way of example, but not limitation, Licensor MAKES NO REPRESENTATIONS OR WARRANTIES OF MERCHANTABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE OR THAT THE USE OF THE LICENSED SOFTWARE COMPONENTS OR DOCUMENTATION WILL NOT INFRINGE ANY PATENTS, COPYRIGHTS, TRADEMARKS OR OTHER RIGHTS.

Boost.Graph license (Indiana University)This\W+file\W+is\W+part\W+of\W+the\W+(Boost\W+Graph|Generic\W+Graph\W+Component)\W+Library\W+You\W+should\W+have\W+received\W+a\W+copy\W+of\W+the\W+License\W+Agreement\W+for\W+the\W+(Boost|Generic)\W+Graph\W+(Component\W+)?Library\W+along\W+with\W+the\W+software;\W+see\W+the\W+file\W+LICENSE(\W+If\W+not\W+contact\W+Office\W+of\W+Research\W+Indiana\W+University\W+Bloomington\W+IN\W+47405)?\W+Permission\W+to\W+modify\W+the\W+code\W+and\W+to\W+distribute(\W+modified|\W+the)\W+code\W+is\W+granted\W+provided\W+the\W+text\W+of\W+this\W+NOTICE\W+is\W+retained\W+a\W+notice\W+(that|if)\W+the\W+code\W+was\W+modified\W+is\W+included\W+with\W+the\W+above\W+COPYRIGHT\W+NOTICE\W+and\W+with\W+the\W+COPYRIGHT\W+NOTICE\W+in\W+the\W+LICENSE\W+file\W+and\W+that\W+the\W+LICENSE\W+file\W+is\W+distributed\W+with\W+the\W+modified\W+code\W+\W+LICENSOR\W+MAKES\W+NO\W+REPRESENTATIONS\W+OR\W+WARRANTIES\W+EXPRESS\W+OR\W+IMPLIED\W+By\W+way\W+of\W+example\W+but\W+not\W+limitation\W+Licensor\W+MAKES\W+NO\W+REPRESENTATIONS\W+OR\W+WARRANTIES\W+OF\W+MERCHANTABILITY\W+OR\W+FITNESS\W+FOR\W+ANY\W+PARTICULAR\W+PURPOSE\W+OR\W+THAT\W+THE\W+USE\W+OF\W+THE\W+LICENSED\W+SOFTWARE\W+COMPONENTS\W+OR\W+DOCUMENTATION\W+WILL\W+NOT\W+INFRINGE\W+ANY\W+PATENTS\W+COPYRIGHTS\W+TRADEMARKS\W+OR\W+OTHER\W+RIGHTS

Copyright (C) Date Author

Permission to copy, use, modify, sell and distribute this software is granted, provided this copyright notice appears in all copies and modified version are clearly marked as such. This software is provided "as is" without express or implied warranty, and with no claim as to its suitability for any purpose.

Permission\W+to\W+copy\W+use\W+modify\W+sell\W+and\W+distribute\W+this\W+software\W+is[^"[:word:]]+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+and\W+modified\W+version\W+are\W+clearly\W+marked\W+as\W+such\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+as\W+to\W+its\W+suitability\W+for\W+any\W+purpose

This file can be redistributed and/or modified under the terms found in copyright.html

This software and its documentation is provided "as is" without express or implied warranty, and with no claim as to its suitability for any purpose

This\W+file\W+can\W+be\W+redistributed\W+and\W+or\W+modified\W+under\W+the\W+terms\W+found\W+in\W+copyright\W+html\W+This\W+software\W+and\W+its\W+documentation\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+as\W+to\W+its\W+suitability\W+for\W+any\W+purpose

Copyright Author Data

Permission to use, copy, modify, sell, and distribute this software is hereby granted without fee provided that the above copyright notice appears in all copies and that both that copyright notice and this permission notice appear in supporting documentation, Author makes no representations about the suitability of this software for any purpose. It is provided "as is" without express or implied warranty.

Permission\W+to\W+use\W+copy\W+modify\W+sell\W+and\W+distribute\W+this\W+software\W+is\W+hereby\W+granted\W+without\W+fee\W+provided\W+that\W+the\W+above\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+and\W+that\W+both\W+that\W+copyright\W+notice\W+and\W+this\W+permission\W+notice\W+appear\W+in\W+supporting\W+documentation[^<>]{1,100}\W+(make\W+any\W+representation|makes\W+no\W+representations)\W+about\W+the\W+suitability\W+of\W+this\W+software\W+for\W+any\W+purpose\W+It\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty

Copyright Author Date. Permission to copy, use, modify, sell and distribute this software is granted provided this copyright notice appears in all copies of the source. This software is provided "as is" without express or implied warranty, and with no claim as to its suitability for any purpose.Permission\W+to\W+copy[^"[:word:]]+use\W+modify\W+sell\W+and\W+distribute\W+this\W+software\W+is\W+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+of\W+the\W+source\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+as\W+to\W+its\W+suitability\W+for\W+any\W+purpose

Phoenix V0.9
Copyright (c) Date Joel de Guzman

This software is provided 'as-is', without any express or implied warranty. In no event will the copyright holder be held liable for any damages arising from the use of this software.

Permission is granted to anyone to use this software for any purpose, including commercial applications, and to alter it and redistribute it freely, subject to the following restrictions:

1. The origin of this software must not be misrepresented; you must not claim that you wrote the original software. If you use this software in a product, an acknowledgment in the product documentation would be appreciated but is not required.

2. Altered source versions must be plainly marked as such, and must not be misrepresented as being the original software.

3. This notice may not be removed or altered from any source distribution. This\W+software\W+is\W+provided\W+as-is\W+without\W+any\W+express\W+or\W+implied\W+warranty\W+In\W+no\W+event\W+will\W+the\W+copyright\W+holder\W+be\W+held\W+liable\W+for\W+any\W+damages\W+arising\W+from\W+the\W+use\W+of\W+this\W+software\W+Permission\W+is\W+granted\W+to\W+anyone\W+to\W+use\W+this\W+software\W+for\W+any\W+purpose\W+including\W+commercial\W+applications\W+and\W+to\W+alter\W+it\W+and\W+redistribute\W+it\W+freely\W+subject\W+to\W+the\W+following\W+restrictions:\W+1\W+The\W+origin\W+of\W+this\W+software\W+must\W+not\W+be\W+misrepresented;\W+you\W+must\W+not\W+claim\W+that\W+you\W+wrote\W+the\W+original\W+software\W+If\W+you\W+use\W+this\W+software\W+in\W+a\W+product\W+an\W+acknowledgment\W+in\W+the\W+product\W+documentation\W+would\W+be\W+appreciated\W+but\W+is\W+not\W+required\W+2\W+Altered\W+source\W+versions\W+must\W+be\W+plainly\W+marked\W+as\W+such\W+and\W+must\W+not\W+be\W+misrepresented\W+as\W+being\W+the\W+original\W+software\W+3\W+This\W+notice\W+may\W+not\W+be\W+removed\W+or\W+altered\W+from\W+any\W+source\W+distribution

Copyright Author Date
Permission to use, copy, modify, sell, and distribute this software is hereby granted without fee provided that the above copyright notice appears in all copies and that both that copyright notice and this permission notice appear in supporting documentation,
None of the above authors nor Author's Organisation make any representation about the suitability of this software for any purpose. It is provided "as is" without express or implied warranty.Permission\W+to\W+use\W+copy\W+modify\W+sell\W+and\W+distribute\W+this\W+software\W+is\W+hereby\W+granted\W+without\W+fee\W+provided\W+that\W+the\W+above\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+and\W+that\W+both\W+that\W+copyright\W+notice\W+and\W+this\W+permission\W+notice\W+appear\W+in\W+supporting\W+documentation\W+None\W+of\W+the\W+above\W+authors\W+nor.{1,100}make\W+any\W+representation\W+about\W+the\W+suitability\W+of\W+this\W+software\W+for\W+any\W+purpose\W+It\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty

Copyright Author Date. All rights reserved.

Permission to use, copy, modify, and distribute this software for any purpose is hereby granted without fee, provided that this copyright and permissions notice appear in all copies and derivatives.

This software is provided "as is" without express or implied warranty.

Permission\W+to\W+use\W+copy\W+modify\W+and\W+distribute\W+this\W+software\W+for\W+any\W+purpose\W+is\W+hereby\W+granted\W+without\W+fee\W+provided\W+that\W+this\W+copyright\W+and\W+permissions\W+notice\W+appear\W+in\W+all\W+copies\W+and\W+derivatives\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty

This material is provided "as is", with absolutely no warranty expressed or implied. Any use is at your own risk.

Permission to use or copy this software for any purpose is hereby granted without fee, provided the above notices are retained on all copies. Permission to modify the code and to distribute modified code is granted, provided the above notices are retained, and a notice that the code was modified is included with the above copyright notice.

This\W+material\W+is\W+provided\W+as\W+is\W+with\W+absolutely\W+no\W+warranty\W+expressed\W+or\W+implied\W+Any\W+use\W+is\W+at\W+your\W+own\W+risk\W+Permission\W+to\W+use\W+or\W+copy\W+this\W+software\W+for\W+any\W+purpose\W+is\W+hereby\W+granted\W+without\W+fee\W+provided\W+the\W+above\W+notices\W+are\W+retained\W+on\W+all\W+copies\W+Permission\W+to\W+modify\W+the\W+code\W+and\W+to\W+distribute\W+modified\W+code\W+is\W+granted\W+provided\W+the\W+above\W+notices\W+are\W+retained\W+and\W+a\W+notice\W+that\W+the\W+code\W+was\W+modified\W+is\W+included\W+with\W+the\W+above\W+copyright\W+notice

Copyright (C) Date Author

Permission to copy, use, and distribute this software is granted, provided that this copyright notice appears in all copies.
Permission to modify the code and to distribute modified code is granted, provided that this copyright notice appears in all copies, and a notice that the code was modified is included with the copyright notice.

This software is provided "as is" without express or implied warranty, and with no claim as to its suitability for any purpose.

Permission\W+to\W+copy\W+use\W+and\W+distribute\W+this\W+software\W+is\W+granted\W+provided\W+that\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+Permission\W+to\W+modify\W+the\W+code\W+and\W+to\W+distribute\W+modified\W+code\W+is\W+granted\W+provided\W+that\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+and\W+a\W+notice\W+that\W+the\W+code\W+was\W+modified\W+is\W+included\W+with\W+the\W+copyright\W+notice\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+as\W+to\W+its\W+suitability\W+for\W+any\W+purpose

Copyright (C) Date Author

Permission to copy and use this software is granted, provided this copyright notice appears in all copies. Permission to modify the code and to distribute modified code is granted, provided this copyright notice appears in all copies, and a notice that the code was modified is included with the copyright notice.

This software is provided "as is" without express or implied warranty, and with no claim as to its suitability for any purpose.

Permission\W+to\W+copy\W+and\W+use\W+this\W+software\W+is\W+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+Permission\W+to\W+modify\W+the\W+code\W+and\W+to\W+distribute\W+modified\W+code\W+is\W+granted\W+provided\W+this\W+copyright\W+notice\W+appears\W+in\W+all\W+copies\W+and\W+a\W+notice\W+that\W+the\W+code\W+was\W+modified\W+is\W+included\W+with\W+the\W+copyright\W+notice\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+and\W+with\W+no\W+claim\W+as\W+to\W+its\W+suitability\W+for\W+any\W+purpose

Copyright The Author, The Date. All rights reserved.

Permission to use, copy, modify, and distribute this software for any purpose is hereby granted without fee, provided that this copyright and permissions notice appear in all copies and derivatives, and that no charge may be made for the software and its documentation except to cover cost of distribution.

This software is provided "as is" without express or implied warranty.

Copyright\W+Kevlin\W+Henney\W+2000\W+All\W+rights\W+reserved\W+Permission\W+to\W+use\W+copy\W+modify\W+and\W+distribute\W+this\W+software\W+for\W+any\W+purpose\W+is\W+hereby\W+granted\W+without\W+fee\W+provided\W+that\W+this\W+copyright\W+and\W+permissions\W+notice\W+appear\W+in\W+all\W+copies\W+and\W+derivatives\W+and\W+that\W+no\W+charge\W+may\W+be\W+made\W+for\W+the\W+software\W+and\W+its\W+documentation\W+except\W+to\W+cover\W+cost\W+of\W+distribution\W+This\W+software\W+is\W+provided\W+as\W+is\W+without\W+express\W+or\W+implied\W+warranty\W+SGI Style Licence (MPL preprocessed file)preprocessed\W+version\W+of\W+boost/mpl/.*\.hpp\W+header\W+see\W+the\W+original\W+for\W+copyright\W+information

Copyright 1993-2002 Christopher Seiwald and Perforce Software, Inc.

This file is part of jam.

License is hereby granted to use this software and distribute it freely, as long as this copyright notice is retained and modifications are clearly marked.

ALL WARRANTIES ARE HEREBY DISCLAIMED

(?4Craig W. McPheeters, Alias|Wavefront)(?5Christopher Seiwald and Perforce Software, Inc)|(Craig\W+W\W+McPheeters\W+Alias\W+Wavefront)|(Generated by mkjambase from Jambase)This\W+file\W+is\W+part\W+of\W+jam\W+License\W+is\W+hereby\W+granted\W+to\W+use\W+this\W+software\W+and\W+distribute\W+it\W+freely\W+as\W+long\W+as\W+this\W+copyright\W+notice\W+is\W+retained\W+and\W+modifications\W+are\W+clearly\W+marked\W+ALL\W+WARRANTIES\W+ARE\W+HEREBY\W+DISCLAIMED|This\W+file\W+is\W+part\W+of\W+Jam\W+see\W+jam\.c\W+for\W+Copyright\W+information|This file has been donated to Jam|Generated by mkjambase from Jambase

Copyright (c) 1986 by University of Toronto.

Written by Henry Spencer. Not derived from licensed software.

Permission is granted to anyone to use this software for anypurpose on any computer system, and to redistribute it freely,subject to the following restrictions:

The author is not responsible for the consequences of use ofthis software, no matter how awful, even if they arisefrom defects in it.

The origin of this software must not be misrepresented, eitherby explicit claim or by omission.

Altered versions must be plainly marked as such, and must notbe misrepresented as being the original software.

|(Definitions\W+etc\W+for\W+regexp\W+3\W+routines)Permission\W+is\W+granted\W+to\W+anyone\W+to\W+use\W+this\W+software\W+for\W+any\W+purpose\W+on\W+any\W+computer\W+system\W+and\W+to\W+redistribute\W+it\W+freely\W+subject\W+to\W+the\W+following\W+restrictions\W+1\W+The\W+author\W+is\W+not\W+responsible\W+for\W+the\W+consequences\W+of\W+use\W+of\W+this\W+software\W+no\W+matter\W+how\W+awful\W+even\W+if\W+they\W+arise\W+from\W+defects\W+in\W+it\W+2\W+The\W+origin\W+of\W+this\W+software\W+must\W+not\W+be\W+misrepresented\W+either\W+by\W+explicit\W+claim\W+or\W+by\W+omission\W+3\W+Altered\W+versions\W+must\W+be\W+plainly\W+marked\W+as\W+such\W+and\W+must\W+not\W+be\W+misrepresented\W+as\W+being\W+the\W+original\W+software|Definitions\W+etc\W+for\W+regexp\W+3\W+routines

Skeleton parser for Yacc-like parsing with Bison,
Copyright (C) 1984, 1989, 1990, 2000, 2001, 2002 Free Software Foundation, Inc.

This program is free software; you can redistribute it and/or modifyit under the terms of the GNU General Public License as published bythe Free Software Foundation; either version 2, or (at your option)any later version.

This program is distributed in the hope that it will be useful,but WITHOUT ANY WARRANTY; without even the implied warranty ofMERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See theGNU General Public License for more details.

You should have received a copy of the GNU General Public Licensealong with this program; if not, write to the Free SoftwareFoundation, Inc., 59 Temple Place - Suite 330,Boston, MA 02111-1307, USA.

As a special exception, when this file is copied by Bison into aBison output file, you may use that output file without restriction.This special exception was added by the Free Software Foundationin version 1.24 of Bison.

(?4Free Software Foundation, Inc)|(\{\s*"!"\s*,\s*_BANG_t\s*\})Skeleton\W+parser\W+for\W+Yacc\W+like\W+parsing\W+with\W+Bison\W+Copyright.{0,100}Free\W+Software\W+Foundation\W+Inc\W+\W+This\W+program\W+is\W+free\W+software\W+you\W+can\W+redistribute\W+it\W+and\W+or\W+modify\W+it\W+under\W+the\W+terms\W+of\W+the\W+GNU\W+General\W+Public\W+License\W+as\W+published\W+by\W+the\W+Free\W+Software\W+Foundation\W+either\W+version\W+2\W+or\W+at\W+your\W+option\W+any\W+later\W+version|\{\s*"!"\s*,\s*_BANG_t\s*\}

The code has no license terms, it has been explicity placed in the public domain by it's author(s).

(?:The|This)\W+code\W+is\W+considered\W+to\W+be\W+in\W+the\W+public\W+domain(?1$1)(?2$2)(?3$3)(?4Public Domain)(?:(?:Copyright|\(c\)|)[[:blank:]]+){1,2}(?:\d[^[:alpha:]]+([[:alpha:]](?:(?!Use\b|Permission\b|All\b|kkHk`k8k2kmk@mk(mmkkkkkkklkkklklklkHlnkkkkkkmkkkkkkkkmkkkkkkkkkkkkkkkkkkkkkkmkkkkkkkkmDistributed under the Boost Software License, Version 1.0. (Seeaccompanying file LICENSE_1_0.txt or copy athttp://www.boost.org/LICENSE_1_0.txt)(?:\s*,(?!\s*(?:inc|ltd)\b)\s*|\s+(,\s*)?(and|&)\s+)|by\s+Cannot open file for license conversion: h}|}|||||||||||||||||||h|||||H|||||||||||||||||||||||||||||8|t jj0wp6j8  r N5boost6detail17sp_counted_impl_pINS_29regex_iterator_implementationIPKccNS_12regex_traitsIcNS_16cpp_regex_traitsIcEEEEEEEEFAfa90^NLAST_SUBMATCH_RESULTLAST_PAREN_MATCHPOSTMATCHPREMATCHMATCHbad lexical cast: source type value could not be interpreted as target Boost Licence Dependency Information����

Boost Licence Dependency Information

Contents

Input Information
Licence Summary
Licence Details
Files with no recognised license
Files with no recognised copyright holder
Moving to the Boost Software License...
  Files that can be automatically converted to the Boost Software License
  Files that can be manually converted to the Boost Software License
  Files that can NOT be moved to the Boost Software License
  Authors we need to move to the Boost Software License
Copyright Holder Information
File Dependency Information

Input Information

The following files were scanned for boost dependencies:

The following Boost modules were checked:

The Boost path was: ^[[:blank:]]*#[[:blank:]]*define[[:blank:]]+BOOST_VERSION[[:blank:]]+(\d+)

Licence Summary

Licence Details

This license is used by the following copyright holders:

This license applies to the following authors (list omitted for brevity).

files (list omitted for brevity).

Files With No Recognisable Licence

The following files had no recognisable license information:

Files With No Recognisable Copyright Holder

The following files had no recognisable copyright holder:

Files that can be automatically converted to the Boost Software License

files can be automatically converted to the Boost Software License, but require manual verification before they can be committed to CVS:


-> Error writing to 7 L Ss `8  8 N5boost6detail26lexical_stream_limited_srcIcSt15basic_streambufIcSt11char_traitsIcEES4_EE4  `P8 @ $6 N5boost16bad_lexical_castEH9   `v  N5boost16exception_detail10clone_implINS0_19error_info_injectorINS_16bad_lexical_castEEEEEH9  4 w  N5boost16exception_detail19error_info_injectorINS_16bad_lexical_castEEE PP @` p P` `` кPBOOST_TEST_CATCH_SYSTEM_ERRORS **** failed to initialize execution monitor.******** errors detected; see standard output for details ********no **** error return code: **** exception(): **** expression at fault: **** error(BOOST_PRG_MON_CONFIRMno errors detected @N5boost9unit_test9ut_detail16callback0_impl_tIiN12_GLOBAL__N_115cpp_main_callerEEE `p6N5boost6detail17sp_counted_impl_pINS_9unit_test9ut_detail16callback0_impl_tIiN12_GLOBAL__N_115cpp_main_callerEEEEE8  , 8  r 7 @ N5boost9unit_test9ut_detail14callback0_implIiEE, 0@P7  7  N5boost19execution_exceptionEN5boost12system_errorEsignal: generated by kill() (or family); uid=%d; pid=%dsignal: the expiration of a timer set by timer_settimer()signal: generated by the completion of an asynchronous I/O requestsignal: generated by the the arrival of a message on an empty message queuesignal: illegal opcode; address of failing instruction: 0x%08lxsignal: illegal trap; address of failing instruction: 0x%08lxsignal: privileged register; address of failing instruction: 0x%08lxsignal: internal stack error; address of failing instruction: 0x%08lxsignal: illegal operand; address of failing instruction: 0x%08lxsignal: illegal addressing mode; address of failing instruction: 0x%08lxsignal: privileged opcode; address of failing instruction: 0x%08lxsignal: co-processor error; address of failing instruction: 0x%08lxsignal: SIGILL, si_code: %d (illegal instruction; address of failing instruction: 0x%08lx)signal: integer divide by zero; address of failing instruction: 0x%08lxsignal: integer overflow; address of failing instruction: 0x%08lxsignal: floating point divide by zero; address of failing instruction: 0x%08lxsignal: floating point overflow; address of failing instruction: 0x%08lxsignal: floating point underflow; address of failing instruction: 0x%08lxsignal: floating point inexact result; address of failing instruction: 0x%08lxsignal: invalid floating point operation; address of failing instruction: 0x%08lxsignal: subscript out of range; address of failing instruction: 0x%08lxsignal: SIGFPE, si_code: %d (errnoneous arithmetic operations; address of failing instruction: 0x%08lx)memory access violation at address: 0x%08lx: no mapping at fault addressmemory access violation at address: 0x%08lx: invalid permissionssignal: SIGSEGV, si_code: %d (memory access violation at address: 0x%08lx)memory access violation at address: 0x%08lx: invalid address alignmentmemory access violation at address: 0x%08lx: non-existent physical addressmemory access violation at address: 0x%08lx: object specific hardware errorchild has exited; pid: %d; uid: %d; exit value: %dchild was killed; pid: %d; uid: %d; exit value: %dchild terminated abnormally; pid: %d; uid: %d; exit value: %dtraced child has trapped; pid: %d; uid: %d; exit value: %dchild has stopped; pid: %d; uid: %d; exit value: %dstopped child had continued; pid: %d; uid: %d; exit value: %dsignal: SIGCHLD, si_code: %d (child process has terminated; pid: %d; uid: %d; exit value: %d)data input available; band event %doutput buffers available; band event %dinput message available; band event %dhigh priority input available; band event %dsignal: SIGPOLL, si_code: %d (asynchronous I/O event occured; band event %d)signal: SIGABRT (application abort requested)signal: SIGALRM (timeout while executing function)::sigaction( m_sig , sigaction_ptr(), &m_new_action ) != -1sigemptyset( &m_new_action.sa_mask ) != -1::sigaction( m_sig, &m_new_action, &m_old_action ) != -1::sigaltstack( 0, &sigstk ) != -1::sigaltstack( &sigstk, 0 ) != -1system_error produced by: %s: %s::signal( sig, ((__sighandler_t) 0) ) != ((__sighandler_t) -1)signal: sent by sigqueue()i/o error; band event %dunrecognized signalC string: %sstd::string: %sstd::bad_alloc: %sstd::bad_cast: %sstd::bad_typeid: %sstd::bad_exception: %sstd::domain_error: %sstd::invalid_argument: %sstd::length_error: %sstd::out_of_range: %sstd::range_error: %sstd::overflow_error: %sstd::underflow_error: %sstd::logic_error: %sstd::runtime_error: %sstd::exception: %sunknown type0`@h8+ kK8+ kK e77  N5boost6detail23system_signal_exceptionE8 h 6 8 y 6 8  6 8  6 8  7 8  7 8  7 7  St12domain_errorSt16invalid_argumentSt12length_errorSt12out_of_rangeSt11range_errorSt14overflow_errorSt15underflow_errorN5boost17execution_abortedE attach shell unlink cont up 4 echo \n list - list/proc/%d/stat%*s%d/proc/%d/exegdb\/%*s %ld!! %s up 2;unlink %s;cont;%s%s-c-q--dbx-displayecho " ";list -w3;-e9x15-fn88x30+10+10-geometrywhite-fgblack-bg-T-x(progn (gdb "gdb -q -x %s"))--eval-titleDISPLAY/tmp/btl_dbg_init_done_XXXXXXgdb-xtermgdb-emacsgdb-xemacsdbx-emacsdbx-xtermdbx-xemacsdbx-dddBoost.Test execution monitor failed to start a debugger: p8  d N5boost9unit_test9ut_detail16callback1_impl_tINS1_6unusedERKNS_5debug16dbg_startup_infoEPFvS7_EEE7  N5boost9unit_test9ut_detail14callback1_implINS1_6unusedERKNS_5debug16dbg_startup_infoEEEd P!  0p6`8  ! r N5boost6detail17sp_counted_impl_pINS_9unit_test9ut_detail16callback1_impl_tINS3_6unusedERKNS_5debug16dbg_startup_infoEPFvS9_EEEEEUnable to open message catalog: Invalid regular expression objectError in thread safety code: could not acquire a lockDEFINEImCvrImImImImwImImImDnImImDuImImuImIm'qtImImImfqImImImImImImImImImImJnztImImImImImImImImImImImImImImImtЈp8H̹Pķ϶7n}}}}}}'϶нȽddddddddddddddddx8Hp8h      X h  0 x      @ h @      (  N N N N N N N  N N N N N N N N N N N N N N   @   N   N 8  x     P 8    (      p            (  H  0 x                   H9 `) ) `v N5boost16exception_detail10clone_implINS0_19error_info_injectorISt16invalid_argumentEEEEH9 )  w N5boost16exception_detail19error_info_injectorISt16invalid_argumentEE) `KPJ) PK@J @::@) RQGP@) RQ@) GPpRQ* pE, 8 + `+ N5boost9re_detail26basic_regex_implementationIcNS_12regex_traitsIcNS_16cpp_regex_traitsIcEEEEEE8 + + N5boost9re_detail10regex_dataIcNS_12regex_traitsIcNS_16cpp_regex_traitsIcEEEEEE8 +  , N5boost9re_detail20named_subexpressionsIcEE7  , N5boost9re_detail25named_subexpressions_baseIcEE`+ pE,pН+ pE,1P1 , PP,0, -0bp6-8 , r N5boost6detail17sp_counted_impl_pINS_9re_detail31cpp_regex_traits_implementationIcEEEET- -0@p6.8 `- r N5boost6detail17sp_counted_impl_pINS_20regex_traits_wrapperINS_12regex_traitsIcNS_16cpp_regex_traitsIcEEEEEEEE- -1.p6@.8 . r N5boost6detail17sp_counted_impl_pINS_9re_detail26basic_regex_implementationIcNS_12regex_traitsIcNS_16cpp_regex_traitsIcEEEEEEEEalphaupperlowerswpunct(?> ?|[ ])/ :A`,P./`8  / 8 N5boost9re_detail10parser_bufIcSt11char_traitsIcEEE  @   0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 alnumalphablankcntrldigitgraphlowerprintpunctspaceunicodeuppervwordxdigit  @ Usage Error: Can't mix regular expression captures with POSIX matching rules1  !  N5boost11regex_errorE8 1 7 H9 1 @2 `v N5boost16exception_detail10clone_implINS0_19error_info_injectorISt11logic_errorEEEEH9 `2 6 w N5boost16exception_detail19error_info_injectorISt11logic_errorEE@2 0- . @2  - . 1 P2 1 , + 1 @2 1 1 p, + 02 1 H9 3 3 `v $N5boost16exception_detail10clone_implINS0_19error_info_injectorINS_11regex_errorEEEEEH9 4 1 w N5boost16exception_detail19error_info_injectorINS_11regex_errorEEE3 @. - 3 0. - `3 0 @0 `/ * `3 0 00 `3 P/ * 0  0 Unknown errorNULSOHSTXETXEOTENQACKalertbackspacenewlinevertical-tabform-feedcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenperiodzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atADPUVWleft-square-bracketright-square-bracketcircumflexunderscoregrave-accentfiuwleft-curly-bracketvertical-lineright-curly-brackettildeDELaeAeAEChCHllLlLLSsSSnjNjNJdzDzDZljLjLJSuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameInvalid or trailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched { or \{Invalid range endMemory exhaustedRegular expression too bigUnmatched ) or \)Empty expressionOut of stack space$+?]|\}0123456789<A`z',:!5 $%  2/4:870;13#&996 !" a  > @ I L > @   > > @ @ G L W W   A D   > @ F L W W  00 #7 7 7 7 7 7 8 -8 ?8 Q8 p< c8 u8 < < 8 8 8 < 8 4     O8 m 8 =8 E= n 8 8  8 8 8 Z 6 a8 8 8 15 q5 8 *   8 8  8 &6 7 . 7 6 K   8 ȁ          a7 5 -n 5 7 l 8 $p 6 u5  i5 on Invalid content of repeat rangeInvalid preceding regular expressionPremature end of regular expressionComplexity requirements exceededABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789._-.. <>:"/\|error: should never be calledgenericsystem\ \ \ \ x\ `\ H\ 0\ \ \ [ [ [ [ [ U p[ X[ @[ ([ [ Z Z Z Z Z Z hZ PZ 8Z  Z Z Y Y Y Y Y xY `Y HY 0Y U Y Y U U U U U U U U U U U U U U U U X X X X U U U X U U U pX U U XX @X U U U U U U U U (X U U U X W W W W W U W U hW PW 8W  W W V V V V V xV U U `V HV U 0V V V U U U U U U U U U U U U U U U U N12_GLOBAL__N_121system_error_categoryEN12_GLOBAL__N_122generic_error_categoryE@ `S PU S PT p_ _ _ @ PS pU S  S U _ _ 8  @ @ 8 ? @ 8 A  A N5boost6system14error_categoryE7 @A N5boost12noncopyable_11noncopyableE@ `_ `  ` 0` p_ _ _ ;X $% A&LB0&BX&H|&L&P&LQ&\R'S(' VL'Vp'\'\'^'^',_(a8(d\(e|(\g(h(j(l(|n )n<)o`)p)|q)\s)t)v*x$*|zH*zd*,}**l*|*̄+<0+T+x+|+|++<+,,D,|h,|, ,ܡ,,-4-X-̦|--ܨ--l.(.L.Lp.ܲ.l.,..L /lD/h////\/| 0D0|h0h11l1|1112,2H2d222 23<4t44@5\6<888\\889<2L2\ 3(3D3d3<333L(4L44l44,5d55,5\55606|P6p6l666\ 7,H7l7 7 7 7 788,8 9\ 9@9d99,::!:/9\192<:4`:L6:6 ;90;:T;|<:<@x;\@;|@;@;@;@<@ <@<<@X<At<,A<C,>|DP>Dl>K>L> N>,O>AB Id8@AB IA@AB I CAB IQTE AB  HE AB IW 4F AB IW, GAB ITLGAB IlIAB IKAB IL@AB I NAB IQ,P AB $ P* AB I[4R^AB HTTAB I tUAB ILXHAB IYjAB I h \D AB O ]AB I[ ^XAB IFFD_AB Id`AB I8cAB I8fAB I$Tim\ AB II |PkŶ AB I  n AB I r AB I TtT AB IF u AB G,u AB GLv AB G l`w@ AB I \xa AB HHy AB GHz̸ AB G { AB I } AB IF <`~ AB I `\$ AB I h/ AB L ԃ AB IF @ AB IF  AB IFH]AB O 4ͺ AB H X$  AB I | 6 AB I AB Ih#d?; AB G #?L AB IF+0@AB [ #@ AB IF#A0 AB J $AL AB I 4$B AB O X$ AB Y |$ Dl AB U $lF AB I $X H AB V $&d AB V|,"AB ,ėAB ,AD  `%`D AB IF,AB $%\ AB LW8-AB GT-(7AB It-HAB H-AB MD&x AB Gd&x AB J-ؠIAB I.AB I4.إKAB GP. AB I ' H AB G $'He AB R H'd AB FG l'OE AB R /<(AB IFM$/H"AB @/\AB \/PAD x/DAB /rAB I /YAB CH/AB G/x7AB I0AB H$(h%0 AB LFK\0pAB L |00AB IFF0)l` AB F$P)l AB CD0AB M)x AB G) AB JH1d#AB Ih1tAB I1DKAB G1xAB I1AG M t*R AB I *\, AB L,2@cAB TL2AB U*O AB G +@T AB I @+| AB L2AB I 2uAB IFF +$5 AB ^<3, AG X3:AB t3+%AB G , ,w\ AB G3l,AB  3p,AB IFF3,.ZAB L ,,w AB I44H.(AB GP4\.AB  ,p. AB H -. AB HD-/ AB Gd-/w AB G-x0D AB G-1l AB G -1 AB K -dO AB L .2(0 AB g5>AB 52AB 52AB 52"AB 62AD ,62AB H620AB d62AB 6=AB 62AB 6=6AB G d/2 AB M8/$8  AB PU  "U  "U  "47h= AB P7\= AB l7P=AB G7T=AB G7X=AB q7=@AB G7D6AB 7E6AB  88EAB OS 88FAB OS\8GGAB  1$H AB I ,1 K@ AB I P1NL| AB Ht1HPQ AB T1Q AB G 1VL AB HH9XAB IFh9tYAB 9hYAB 9\YAB 9PYAB 9DYAB 9~AB :}AB ,:}AB H:}"AB d:}AD :}KAB : ~AB :$~AB :(~AB  3AB  >AB <>AB  X>UAB IFI|>Е AG >ĕAB >ȕAB >SAB G>gAB I ?PXAD LE,?AB H?AB d?xAB ?lAD ?`AD ?T"AB ?hAD  ?\$AB LV@hAB \ 8ؗH AB IFX@DAB t@HAB @LAB @PAB @T+AB G@h2AB GA+AB GAFAB G 9Ԙ` AB L\AAB I|A@AB IAAB IAAB IA0%AB GADAB :HAt AB J4BxAB PB|aAB  :Рd AB IF$ ; AB IFC$H; AB RJB,AB I C̢AB IFH$C8MAB S DChuAB IFF$;ĥt AB IFF CAB JFEC(AB G `<  AB Y CxAD GJ DAB LFL <) AB H <,9 AB HDAB I4=p AB GT=w AB Gt=xw AB GEخbAB IF$E(1AB LDEH1AB L$=x AB SC>@ AB G<> AB G$\>P AB IFGE(cAB TFxAB U4FiAB I >H AB I ?ԽeM AB I ,? e AB I P?l AB H t? AB K ? AB L ?(X AB N ?r  AB ItGAB GGAB IG\AB IGAB I @4 AB K @8T@ AB I$@tq AB IW`HPAB H$Ap AB IFUHd4AB I XA AB I |A` AB O A\5 AB H AC AB H AtQ AB H B` AB L 0BU AB I$TB_ AB LFE |B AB I Jl tAB IJ B  AG I B4  AB I|JAB O ,C7S AB IJAB IJ|"=AB I C% AB L$K4 AB @K3tAB R C\4l H AB NK>>AB  0D>P AB H TDB AB IKE AB  DE AB I(LJ AB DLxJAB IdLHOAB I ER, AB XLR AB  TEX{a  AB E xEdRP AB I ES| AB M EW AB H TM(XAB IH$FY AB IL 0F|]   AB LMgoAB G pF    `=     -TAa%6"1r@Tr\p|oGK/97!({:I]eu4 ^ u   "          Q   "  %M0^)PP },=&fd'R/_A    3    Je>UqzeW^S@}}fq9.   N   5+Iu0 %7Uq}}y9)#]2 C ~}}y}{}9(#U2 C{ v}}y}{}9(#U2 C{ v}}y}{}-Q},PE0*d9 J }}}y}{}A/*\9 J} }}}y}{}u\ E : }}}y}{}}%7Uq}}y74<R`74<R`W')- Uq Uq%7]y}}y:e=4         N>P^,1Gp91L J=e e_,A80  _'5D[i            %-'"(  1   '           $         pOXihmmililim j k m m /k kl m j l l p l q q qqqqqqqrqlk2m7qqrrr1rr#qrsrsrqsssfsqh#iiij-f_gmmmnmnnnnooo o o o o!:o"$o"o"p#o#1p#o$&o$p$p$p%s%p%o%s%t&s&t&s&o&m&i't't)t)u*u+o.u//e5#t7Qh8Fi9h:i:e;JtJ1eKtKtM*cN}N}O}OiP}P}P}PiP|QtQ|Q+iR|RkRiS|S*|T|T|T{U{W{XzYzYzYzYzZzZzZyZy[y[y[y[y\y\y\x\x]x]x]x]x^x^x^w^w_w_w_w_w`w`w`v`vavavavavbvbvbvbvcvcuegFihmhij jj mjFkklmhm mmmtttou u|}dt M(5(&&'d'))f' ( (  , , + , ", + + + ", +++",+++",+*+",***",***",*0*",///",///%,///%,///%,...%,...%,...%,...%,---%,---%,---%,---%,,,,%,,,,%,,,,%,,),%,)))%,)))%,)()%,()(%,) ) ) %, ) ) ) ,!'!(!("'#($%'&'& '''''()[E\dni>]  R N     *        6   6   (D }#3T\id}}(D }0L }d$R,_";>"0a;F|1k| '` %%;U}%%;UB}) #n5HxT\ns,b8A    3    9'8-TAa!&y8G[c 4kf I2[:V@@@#;\dql}}#3T\id}}"7]Brm"7dIyt7J3N},zG!*Bckxsz}}}!*:[cpkr}}})PP }E8#[?8}d'R/_Q|[%=Um[%=Um[%=Um Uq%7]y}}y%7Uq}}y-Q},P%*B0hcmzu}}}%*;0a\fsn{}}}5+Iu0 %7Uq}}y=+$O m }}y}}y=+$O m }}y}}yy7?Xi}}}YP4F^fny }=+$O u }}y}}yzJ=4           BM e_KG*,$*,(((''&$($***)*$))))))%$)))()$((((((%$ ( $ ( $ ( $ $ $ $ $ # $ %$ + + + + + $ + * * * '$ * '$j*+*'+*=++,##,*####"""!! !C..---,,,,,,, E# !!"""""###%'%'%'&'&'&'&'&'&$*,.}}}5+IuH5+Iu09%PP } U}- $u }}y}- $m }}y},P-Q} U} ]}5&+} }}}y}5&+u }}}y}r E }}}y}}}/4[/+K/-W/3?_44[:+P_3AwNjL       F     m]lPD8X}}4'` %PP } UqJ e9.   N  7 9 Ejq!!fqA    3    B #3T\id}}#;\dql}}%PP }3N},zG!*Bckxsz}}}!*:[cpkr}}}-$+W-Y  F                        }}}%K/%K%K/%K%PP } - } %PP }(D }(D }0L }.E.Ed$R,_'` 5+Iu %*=a9};JZ!&y8G[c!({:I]eE>    `=     )PP }E8#[?8}Je #V.lg! "[f pzff>UA    3    d'R/_!9'ZUv~}{}-Q},P%*;0a\fsn{}}}!9'ZUv~}{}!A'b]~}{}&ZJe #V.lg! "[f pz &^1to!>U 9(#U2 C{ v}}y}{}9(#U2 C{ v}}y}{}y7?Xi}}}9)#]2 C ~}}y}{}&Zzz &^1to!A9     g    `h~'0A9     e    ,'0q* *"G      /        L]w* K*1!! ! -! !     # 3# ## ""  !# #-#*# "#  ! "#E0*d9 J }}}y}{}<K[.EJ\nA    3    JebF]s>U&Zj"Ne{Y!,7EA9     e    ,ypM  .              '` fq4? jcbbaa`aaˆӇՊӇʊŠ      ȅ  ʅ  ȅ        قׂՂՂ€ցց€xxxxwxwxwvvvvuvvzzzzzyzzyyyxx~~~~~}}}|}} } | |!|!{!|!{!|"m"m#m#l#m$m$m$l$l%l%l%l%k&l&k&l'o'o'o'o(n(n(n(o)p)p)p*p*o*u*o+p+u+u,u,u,t-s-t-u-s.s.s.s.r/s/r/s0s0s0q0q1q1p1q1q2q2j2j3j3i3j3i4j4i4i5i5,i6i63i7i7i8i8i8h8h8i8g8i8i8i9g9g9g:,g:g;3g<g<g<f<g<f<f=g=e=g=g=g=e=e>e>,e?e?3e@e@eAdAeAdAdAeAcAeAeAeBcBcBcBcCcCbCcCcCcCca)PP }(D }#3T\id}}0L }.E.E-#.D\n;} >|,zG#;\dql}}E>    `=      `3N}!*Bckxsz}}}!*:[cpkr}}}JeJe%%;U} #V.lg!>U>UbF]sA    3    &Z&Z%%;UB}j"Ne{ &^1to!A9     e    ,A9     g    ,:=1*b" })%:r}: 1&GB =1*b( })%m}'` ffzz<6A9?998888199 1 4 > 78777@@66566@=@O@7826 5 5 5!5!?!6(?(=)6)2)?)=,@-7->0#21 212224445665666 6677 8889;nc<L<`<`    `=     ,zG At A}(}3N}#;\dql}}#3T\id}}#3T\id}}#Ahp}x}}#9`hup}}!*Bckxsz}}}!*:[cpkr}}}!*@go|w~}}}!*How}}}A3l? }}}})PP }E8#[?8}d'R/_ UqJ e_:%7]y}}y%7Uq}}y-Q},P%*B0hcmzu}}}%*;0a\fsn{}}}%7Uq}}y=+$O u }}y}}y=+$O m }}y}}y=+$O m }}y}}y)XP'` z5+Iu0}q7a}}}=4           *QLLL@LK/KNNIZIN I K J O N NOOONNMfMRNM^EN,lI.D.E.D/E/D1E1E2I2H2/H3H3D3H4D6\N7D8N89B;C<C<A<C>D>@?A??@AAAAADB!CBCBCCCDEDEDEFIKLL}}}s M >   f  !     }}  hRf !     }}  8Ju;8Ju; MG  +)    }}}}}}} } } } } }}}}}}}}}p8 D H: $6 09 5    $ 0 < H T 6 7 8   `   ju)!6 E%%8i}">>   Teq         ,5. "[l u`7 +<+R?_.l?~Vy%-Nl}#3T\id}}3bo(v ^ !e<wr,M#3T\id}}#Ahp}x}}#9`hup}}#9`hup}}#;\dql}},zG3N}3T}!*Bckxsz}}}!*:[cpkr}}}!*How}}}!*@go|w~}}}%%;^}E|::":Rw%=UwBVE%1>rE'` zzfqfq'pDx{-37@,;RKb6zr[     u u u]P5 D n            }}} %Slt,Tu ]SS=oA    3    E>    `=     E>    `=     /5       ~e  =4           >j u    5  9.   N   A9         \ =4         J*N]r-4   C= }) .\s aW9g~ J us;.1d  ]P5 D n            }}}$ZUK. "'_hu:,zG3`}:3N},zG3N}#3T\id}}#;\dql}}#3T\id}}#Abjwr}}#9Zboj}}#;\dql}},Y!*Hiq~y}}}!*@aivqx}}}!*Bckxsz}}}!*Bckxsz}}}!*:[cpkr}}}!*:[cpkr}}}Q?xG   }}}}}Q?lG   }}}}}]P=Lv}}}6Z%>FYQ F  .5bAP5+Iu09%PP } U} U}- $u }}y}- $m }}y},P-Q} ]}- $m }}y} 4y5&+} }}}y}5&+u }}}y}mZ E }}}y}}B'-ED V        s O      }}}m]lPD8X}}-V%PP }Z .V0`]w К0P F O \ Ra 0 b o4T  / @ooo . vƾ־&6FVfvƿֿ&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv/tmp/btl_gdb_cmd_XXXXXXh0 / 4 4 4 4 5 5  5 5 5 /5 5 &5 35 =5 M5 P5 S5 W5 [5 _5 c5 g5 k5 o5 s5 w5 z5 ~5 5 5 5 5 8 5 5 5 5 5 5 5 5 5 6 6 "6 (6 /6 8 66 ;6 ?6 C6 I6 N6 S6 W6 ]6 c6 l6 h6 r6 6 6 6 6 6 q5 5 6 a7 8m l g7 Q5 7 i5 X7 x5 u5 N5 6 5 on v7  6 6 6 -n $ 7 6  8 6 6 6 7 &6 15  m  7  A 7 7  m7 o . x $p  7  6 7 K 7   7 7 .7 <7 P7 V7  Z7 ]7 `7 7 c7 f7 i7 l7 o7 7 r7 u7 x7 {7 ~7 7 7 7 7 7 7  bcpM.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.gcc_except_table.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink TThh !$84o> TT F44No  4[o6j 7s 7@ |00>0w``> J b  @b @d A \X HZH H2m. H. . . / / , 3   5 ܵh ܵ
Files that could be converted to the Boost Software License


The following  files could be manually converted to the Boost Software License, but have not yet been:


Files that can NOT be converted to the Boost Software License


The following  files cannot be converted to the Boost Software License because we need the permission of more authors:


Authors we need for the BSL


Permission of the following authors is needed before we can convert to the Boost Software License. The list of authors that have given their permission is contained in more/blanket-permission.txt.


Copyright Holder Information
File Dependency Information
For brevity, only files not under the BSL are shown

 (Circular dependency!)Error opening  for output. for    (see details)


 files:





This license applies to 
The following 
[] File: