ELF48 4 (444  TTTD D  ^^d"< ^^hhhDDPtd BB$$QtdRtd ^^((/lib/ld-linux.so.2GNUGNUI!q" Gt<'@?kGL1CP.#XyM/Y&)%g|I"hV (, SHZqp\z~3aFo4K{r:l;=^mwf 0+8B$OJT65W` !2d]bND[eQic}7R>tnj-A*suxU Ev9 _ a  ߄t.ZUfqXK|R #g>N]8CE嫐LcV*tVgUai OG)}Z{H;> l  &v 4qKUf }1~cA33OV%GS@ NTN:X]HjA"]s.];zqcyUMA a4iol<NGEu1,gkd r|$HE <1XT`{>-L <@DRX`dPlibresolv.so.2__gmon_start___Jv_RegisterClasses__dn_skipname__res_query__dn_expandlibz.so.1inflateInit2_deflatedeflateInit2_inflateinflateInit_inflateEnddeflateEnddeflateInit_libbz2.so.1.0BZ2_bzCompressInitBZ2_bzDecompressEnd_finiBZ2_bzDecompressBZ2_bzCompressBZ2_bzCompressEndBZ2_bzDecompressInitlibreadline.so.6rl_catch_signalsrl_cleanup_after_signalxfreerl_instreamreadlinerl_completion_matchesxmallocrl_free_line_statexreallocrl_attempted_completion_overrl_attempted_completion_functionrl_inhibit_completionrl_outstreamadd_historylibdl.so.2dlopendlsymdlclosedlerrorlibusb-0.1.so.4usb_bulk_readusb_clear_haltusb_openusb_find_bussesusb_initusb_get_bussesusb_control_msgusb_claim_interfaceusb_bulk_writeusb_release_interfaceusb_closeusb_find_deviceslibc.so.6_IO_stdin_usedsetuidsocketmkdtempfflushstrcpyshmgetsigsuspend__printf_chk_IO_putcsetlocalesrandstrncmpstrrchrregexecpipe__strdupshmatdcgettextconnectgetpwuidftruncate64mmap64__read_chkstrncpyforksigprocmaskregfree__stack_chk_failshmctlunlinkselectmkdirfsyncclockabortstdin_exitmemchrmemrchrgetpidkillstrspnbind_textdomain_codesetstrftimechmod__assert_failgmtimestrtokstrtolisattyexeclpfgetsgetpwnamcallocstrlensigemptysetmemsetstrstr__errno_locationrmdirtcsetattrmemcmpmlockttynamedup2clearerr__fxstat64__fprintf_chksigaddsetputenvstdoutfputcfseeko64getrusagefputsmemcpyfclosestrtoulstrcatumaskstrcasecmptimegmraiseremovenl_langinfo__xstat64getenv__ctype_b_locsscanfregcompstderrsystemsetrlimit64munmap__snprintf_chk__memset_chkgetuidstrncasecmpfilenofwritefreadgettimeofdayiconv_closesigactionrenamegeteuid__memcpy_chksys_siglistwaitpidlocaltimelseek64strchr__vfprintf_chkmktimeiconvfdopenqsorticonv_opentcgetattrsleep__ctype_toupper_loc__ctype_tolower_locfcntl__sprintf_chkunamememmovefopen64ctermidbindtextdomainaccess_IO_getc__strcat_chkstrcmpstrerror__libc_start_mainferrorstpcpysysconf__cxa_atexit_edata__bss_start_endGLIBC_2.2GLIBC_2.0GLIBC_2.1GLIBC_2.3.3GLIBC_2.4GLIBC_2.3GLIBC_2.3.4GLIBC_2.1.3      0ii $ii .=0ii 8ii .'si Bii Nii Xii $ti bii 8si nii ._@DHLPTX`d``` ````` ` $` (` ,` 0` 4`8`<`@`D`H`L`P`T`X`\```d`h`l`p`t`x` |`!`"`#`$`%`&`'`(`)`*`+`,`-`.`/`0`1`2`3`4`5`6`7`8`9`:`;`<`=`>`?`@`AaBaCaD aEaFaGaHaI aJ$aK(aL,aM0aN4aO8aP D$$D$D$$ D$Ɖ$4$> [^_]ÐD$.<$LD4$h> D$D$$ Zt&D$D$$c D$Ɖ$En$= [^_]Ðt&D$D$$t$$8 (vUWVSl}EUNjUMeE1$i 0wɉS1ۉ t&ot+$ׅu$t&Uȅt$"ot uՍF0ۉu1$3? EUEEEUt&o$ׅu$UȅEtޅ>f, VFEЉU$U<Eԉ$D$U}ttUE܉\$D$ D$T$D$$U܉4$T$oPt&tf Ue3El[^_]Ít&U$ƋEMȉD$Ẻ$B< MÈ8t&8uf ɉE‰ED$<$duUUЉUẺT$$:EЉ$C UE)v E $D$D$p$XfD$D$D$8fÐ}ÐÐD$D$$fÐÐD$D$$fgD$D$ˮ$w 1$w Ðt&D$D$Ԯ$[pm S$l afD$D$ݮ$ H$ fD$D$$ ~Z$xÍv'UWVSTE $DŽ$DŽ$$DŽ$e$L1DŽ$DŽ$|$D$$Ƅ$1|$D$$^Ƅ$1ۉ|$D$$L1u $T$0D$D$FT$0u $T$0D$D$!T$0u $T$0D$,D$T$0$ $YP; $= $56t D$41$u~ D$u$D$$#$# hlH\`d`Й$( 00ؚ$tD$ D$$I$tD$ D$$P=v P=v ̙ ;;螪uu$$1ۋM$E|$<L$@$t$xDŽ$|ADŽ$DŽ$$tD$ c$$ _$<=M*===y=t&=t&t=tb=Qfo$D$$cC $EKD$TD$$ru $yԙ$$Ԛ) $Ԛ H$uu$̚1$=ԙ$tD$$@$; 0wD$8R9D$D$$3 à O8 D$$$$o8 ,D$$҃$8 DD$$<$1V 1$D$Dt $4 ËD$ D$x$@#$1$$KN  ܙ$$8$$D$D$$Yt$\$$U p%dU$D$ı$> :̙'DŽ$$$$$$ ؚؚ$Ԛ |$Ԛ aܚRC4$$m$ WDŽ$$ 6DŽ$$ DŽ$$ DŽ$$s$]$G$DŽ$&$u$_$D$+D$ D$=D$$$D$+D$ !D$=D$$Ԩ%,%0$D$.D$ D$D$$薨$D$.D$ !D$D$$k , 0 ($$1$D$p$lhĘ ,$<$D$$D$w rc$sMD$$D$$$* D$x$$ =$+'$*$'$&$%j$$T$#>$"($!w$ a$K$5$$ $8D$$*$[L=$8-D$$荿)$ $2$1$0$/o$c$.M$-7$,!ș$|$@1$tL$<T$$$$$$$eb$D$$2 $e>$$4 $D$$Y2 $4$@$5$ $$X# $$% x$5# x|lx$# x|F$86x'$t$D$D$ D$D$$ ,$D$$$ $D$$$s $@$D$$$F q$b S48=8D$L) $$$҉$D$=$ǃ$$$$D$ 5Кa$$v9\$$u㋜$t&< R< uGf< @< 2u1T$<$D$ 띋$$$$$p$D$X`$|$lP$L$T@$\$D$D$ $$O$#$8$4ĚĚȚ$<$<$D$ 5Кt1҉$&F5Ɖ|$$u߉ڋ$/FBF$ 4$ $$-$D$D$ D$D$$ŝ $$xiZ% $t zxD$$T$D$ P$D$3D$H$wD$xd$ $D$xdD$ PD$eD$$h3$"$g* %||xx$$ $裔$$O$usd$$D$ >$D$$w* $D$ TD$$D$$$ $@D$$D$$$ $@$$s  q$P`|$,@4󥋄$$D$ T$D$0$f$D$D$$t$\$$ |$,@8󥍄$D$$$DŽ$u$D$ D$,$$ĕ , $_R$ ;$D$D$($$D$D$$t$\$$ $$U$D$D$$ft$\$$b }niX dt&[K<-$D$D$$$^ $D$D$$诿t$\$$ $\$D$D$ $$HMP$Xv$1~J=11Ƀvw ȉ!Ƀ9$$ D$h$$ $$PPLLTTsXd$$ M$D$D$t$t$$  DŽ$@LHD$|D$|e $ $T$`uĘ<R$A$1)$D$$b$ $$1$$D$$$ $$$ap$l|$hk$|1T$0T$0f|| DQu4$ D$t$$ D$d$$ $$$ $șșș{șlș  x|ЙLH\`dș%x|ЙLH\`dșP% $DŽ$$?!$1$\$PD$\($2xۋXu9wڅ\$Pt;t$\s$D$D$$$ $$lL$ $H$D$3D$ D$GD$$$D$3D$ !D$GD$$Ӑ%,%0$$D$D$ D$D$$脐$D$D$ !D$D$$Y%,%0$D$~D$ D$|D$$$D$~D$ !D$|D$$ , 0$8D$$ܙN y$D$6D$ D$D$$~$D$6D$ !D$D$$S , 0$1$1$n$X֐:v<$t&w$t$1. DŽ$V$1$D$D$$ t$\$$ $$$  $ƉКFF5КD$4$̉ 4$1$R D$tfZ$T$tD$$}$D$D$<$.t$$. I$D$D$$t$$: $$ ؙ$D$`$ ̙ {$DŽ$$R $ ~$$d1$F1$D$D$ $T$ .D$D$$$D$D$2$D$D$>$ڰD$D$N$辰$莻D$4$讇 4$,2$ |$$ 01 v 0ɀ Ƅ ut< <,u"&< <,u1D$ D$$J^Ƅt u~$$- F$" 0$[Ѐt :2y):p5D$D$$˱$ϳ $ $ |$D<$ |$p$t~$$ $ \$t$D$`D$D$ L$$D$D$D$ L$=~ $kD$> |$4t =H.$tG=ؙt4D$D$$诰D$D$$ ؙò==t,D$D$$[D$$藲 =t $ - $ |$|%|$8D$D$$D$($0 $ԷD$D$\$輯$L$$赱 D$D$$舯\$$ȱ =D$D$$[$_ zD$D$$2$6 QD$D$ΰ$ $ (D$D$$$ FК$D$±$ۂ  ̙D$D$$|$耰 D$D$$S$W rD$4$b  KD$D$$$ " t y t  t t Șș .-t&.$t@$$QpH+$$% H$xn+$t8$$觊$ $\ \$-|$tt.|$t<$ <$d d$y-|$dt2D$d$6T$d$`u `$舂-|$ht2L$h $]o|$h<$< $mv-$t8$$辉$$ $ ]-=5=5=v$D$D$($ī$ȭ =v$D$D$\$藫$蛭 v$D$D$$f$j t1t,D$D$$+$o 4tD$$M4|$l,|$TtL$TD$ $ȹ,|$lD$<$謹5,|$XtD$XD$$艹;,$t-$s3*b3ct&3$v˪ c=hu d=ștQH*\)`u)dt D$D$$(|$H}2|$L$tu$8$1$u =o=~ $v$== d2=O=D=$t[=tTctO$$1u)1D$D$$n$$uы$ۉD$D$$-$…$t5D$B$D$$҉$uҋ$$ $DŽ$$ $DŽ$t$$.T1ۃ}t$t=t $ %D$`$D$o !$==cs=v=t&E$DŽ$D$$$D$ E$Eǃ=$svDŽ$fU+=&+fc=t&0fd&)f$K&*+c&*}~!D$D$$L3)$; )$! $ r$)=@+$u$Dt$$>t$ $D$辧 4$3 $$w $DŽ$$] DŽ$$fe*s$DŽ$=+E$+$$D$ E$E=w'=v&=t&h}~!D$D$$贤蛶$蓨$ $9 t$$D$腦 D$D$$X$\ (=f-=t&c-=t&{D$D$$D$\$$ $$sƒ$=D!=9!}!et&_!W!cN!$PL $Й $sR $<$$ $s0 d$p$D$D$H$ˢt$$ˤ D$D$ $薢$ڤ Uu$D$D$H$at$$a |D$į4$lv U1-|$(~$ $ @D$D$$ʡD$̲$ ==ؙ $uD$D$$pD$̲\$$h $hD$D$-$*t$\$$& $ $D$ʱ$#u #̙ =t}~!D$D$$覠荲$$D$ $z $ t$$<D$l = = &~E$DŽ$ZT$$D$D$, EE=n|$xc=VD$D$h$趟$ $& KL$`$L$7=$$&=t&fv=t&zf=t&=t&E$DŽ$(D$$$D$? E$E=sn}vt!D$D$^$莞u$=DŽ$=xD$D$ $ѡ == }u!D$D$}$ 荨}E$$DŽ$E1$4$D$ E$E=d= =t&$M1҅t$D$ D$L$$8@g|$`1}|$$]=tt&vw<DŽ$E$/D$$$D$ E$Eu͋$$z$$l =$*$D$E$x$H $D$H ="&E$DŽ$D$$$D$ E$E= =j"=t&0}t uz$ Ë$$D$'$? =,S#&@='t&f=%t&"=&t&}!$$?/U$҉U$u&="B"!fs,v=*JfvkE~ tE1҅t $$J$Z D$D$$@\$$@ =(}t&t ^g-\=/|&w6=-=.t&h}t 貫=1vtls4}ft u脫D$D$$=2Ef|=7}=E$$DŽ$E$$D$ E$EЍ$D$r4$ D$x4$ GD$D$ Ë$$D$$D$G[$_ $$P $D$4$T (E}t ,#~)$$j$$ `E$DŽ$D$$$D$ E$ENjE$DŽ$D$$$D$ E$ENjE$DŽ$D$$$D$ E$ENj$$}$$޶ S$$0c$ $JD$ژ F$$&%/$ D$D$,1$$#$s D$D$$Y\$$Y $D$E$$ $D$ c}~O$D$ D$$薕:t&u }蚧$ D$I}tk$ É$2$J E$EuE~ Z.E1҅t $$D*y=E뷃}11DŽ$ܶݦۉ$$= $$D$|$$p=$Et$$3¡$T$0D$T$0$) 1ҹ$$ $$$b@cH$D$ D$${NjEj1DŽ$}&t T$踟$D$ D$@$1$Ei$D$ D$$角D$$c8D$$J$Y D$ D$Ë$@$ID$ D$Ƌ$@$%D$\$ t$$D$RD$D$$8j $ D$חD$\$$ j $Ҏ S}?$D$ D$@$腑D$ D$Ë$@$a$T$D$ \$$D$QD$D$$mi $ D$ $D$D$$6i }s$D$ D$@$蹐D$ D$Ë$@$蕐D$D$ \$$D$-QD$D$$h }$D$ D$@$'$\)u$=D$$=D$$D$t$ $D$ E~$D$D$[$ѡEZ DŽ$1$D$D$ $T$$T$$T$й $ $& t$$wD$r E D$D$l$9 $1}1DŽ$$$9$$<1򮋼$$T$0)ω|$ T$0҉$$$D$+1딋$= = (D$$$$x M $/ D$D$D$<$蜒L1=,$$61$zD$ $$t $D$f1$a 9D$$a uRD$$~D$ :D$D$}$š D$=b$ED$$Aa u7D$$w jD$=b$D$$` u7D$Ƿ$͉l D$=b$诉D$ӷ$` u<$xU $$Ut&D$D$$$W $Tld$YSø tzt&#ND$D$$詀t$\$$ `SD$D$$sk`$VøpMD$D$D$D$$! \$\VøD$D$$H$Aø"MD$D$LXLD$D$H$4$8 5D$D$p$ $ AD$D$$~$ QD$D$ $~$轀 aD$D$H$~$蔀 zD$D$@$g~$k D$D$h$>~$B D$l^-D$D$$~$ '}v~!D$D$$}轏$D$$D$袠$ $H t$$ɴD$ =tAE~ TE1҅t $D$D$$}t D$D$$^$$ѱD$~ $uT}~!D$D$$|觎$$ $/D$~ $D$E$4$ &x$ D$D$b=d$w$|$w$|L$mw$|D$D$${$~ u}~!D$D$${y$Q$q $ D$D$E$DŽ$t1D$$$D$I E$Eˋ$$X$$Ț =4$K=$$T$D$_4$ $uu}~!D$D$b${zbD$$$D$'g$G $ t$$D$9| ~$D$$D$E$#rXE~$D$D$5$yŋEt,1у $( \$$${$D$D$D$ D$$D$$$襣$U $GD$U{ }t ` $貃É$(]$G L} Ҋ$8*$XVE$Etc$ڋ虎E$Eu}t?$1iU$҉U$u?111$D$D$1ۀxC,E~ ډE1҅t $$v"$ D$D$Ŷa=u8DŽ$ <~(~<ĘD$D$ʳ$Q É$WID$$+wu$B$ 3D$D$$ֳ肊$}|fwD$D$A$v$x io_aUD$D$$Rv$Vx VD$D$$)v$-x }t&~&D$D$$u݇B=t)șwE,CD$D$4mD$D$$u$w D$UVS]u C&$, C$! C$ C $ s$ uă[^]Ðt&UWVSLEEU܉T$UT$UED$ D$B,$]sEv"sS{ S ׍T79t)D$D$8$t$v x$ FUЉ$4 UЍKt$L$$uUЋ0;UЉ<$ UЍL3zB L$|$$uD$D$$s$u$ UЉBf[ @UD$D$$sUЉD$B$'xUЋZ$9uf ]CUBM܃ ȈBEԉUԉB_&EԃL[^_]Ðt&GUЉ$ UЍL3B|$L$$tUЋB8땍UWVS,$[ NjE-!a=uE@tK*GucD$D$`$r$t <$1,[^_]Ít&E#sۋXfx t=u+]C$ U\$T$$o]}>tFE^Eu%rۋXfty܃EuUE E$躚 G ffvOEUfvOEl$ uf !D$D$$ q$s yD$D$$p$r PU$ GfED$D$,$p$r fUWVStzfct&wՃO=t&뵉D$$U D$$ U,h$h t&USÃ$t"E$D$\ U$T$D$ $[]Ít&'UWVSˁeE1y~A1ɅtHK$MC 4$D$ C4$D$ {~!1D;4$D$ 9{SMރ1҉.&|$D$$ D$D$F$T u߉Uf9u@tKt59tD$|$$7f Ue3u@[^_]D$4$ t9ulj߉DžrTgUWVS<] uCs P v&1Ʉtd=vD$hf $$D$6e 멍t&SJr$Szuƃ΀fSzmvSzƍt&[SRK$ECD$CD$E$ U1ۃ<[^_]ÐCx  1ɅtJH$E1D$U$' 벐t&KE뜍&C1ɋtH$E1Em[1ɉ$E*C1ۉD$M $ =[ C*D$<$ 2{wC1҅t +E.pC<$D$P C$$,E~+1҉uЉމӐt&Dp<$D$@ 9]uCO,$EW|$M $[ C JD$<$ j{ wC1҅t +E.C<$D$ C$*EC$M+EE9Ea 1҅E~,ủމfD`<$D$? 9]UԉủÙ{1#C<w{ wC89&{5<$D$ C4<$D$ C8=D$e<$ C<<$D$ D$D$<$ C8<$-D$m C8!vCL<$D$CMD$ C8=tV=7{1M9MЍT`~*uԋủ]̉Ӌ<$D$l> 9uuԋ]SxC O,$yf[ D$lj$ C<$D$ C <$D$ C <$D$~ %SC <$D$[ O,$E|$U$H <$Ӄ <[^_]Ít&[P ;Kw L$$>a [ C"D$<$ {aC<$D$ {C<$D$ C<$D$o {vqC,fHщM^MȅtL$C,<$D$ C0 HщM&MȅtL$C0<$D$i C4<$D$ C5<$D$ C$&E0~&1҉uЉމӋD8<$D$"< 9]uC<w {SO,$E|$E$#[ D$lj$F { SC <$D$ C $%E~$1҉uЉމӋD <$D$c; 9]uЋO,$E'|$E${1҉_1҉VxD$<$ vD$<$x vD$<$` vK$ECL\$D$U$ vD$<$ C<$D$ C<$D$ C<$D$ CCO,$ES8S`S S St&D$<$8 vS FSpD$\$<$j Et&C D$D$<$I {C<$D$ vD$<$ C<<$D$ *&{ Uԃ8$U P UȨ"ED$$O U<$T$D$ _t&_,D$E$ D$U$ \$M $ fD$<$ C8E9E‹D`9Td}ԋ}ЉuЋủ]̉&$+O ML$C$O UT$D$Eԉ$ 9}ԋuЋ]eC=D$D$<$ C8CH<$D$ C81҉ 1҉CL<$D$ CL<$D$CMD$3 C4<$D$ \D$ D$JD$$1VD$ D$mD$$4VD$ #D$ D$$0VD$ D$cD$$mVD$ D$D$$IVD$ D$$D$$6%VUSEMU ]xQB!|t]UE WM[] ft3D$D$j$?Z &B볍&]UE ^M[] u[]Í&'UED$ D$E D$E$)Í&U t&UWVSÃ<ME_&E4$D$Stzu|VC)D$CD$U$ FCF CFtUD$T$ F$|D$EW p}uFt&tD$$Y D$ |$T$V$T$EV EMt }a<1[^_]Í&$V <[^_]É|$$X U]] uuC$!¸t]u]Ðt&$( @$USPSD$T$C$t#ED$C$C]u]ÍvCD$E$؍UWVS\E uU^:t,A1\[^_]Í&uj$8& ~FD$8D$$EWUą+F $UK UBF{M~CK fV tL9vHuF)T$FD$E$U Uă9<9~ ~{D$$dRuOtst"tSaT$$5[V vK?7{8D$ ST$S$HT$ET EăuKV)ʋMIT$$|ES E.t&CD$C$D$S 11&FPEUԈEٍEEEEUD$E$\$8ܬ ‰ÉFhHvt$UTS Uĸ~:$D$ 8D$D$UNUąF $ ի FUM{ډ $1\[^_]Ív 4F$4$Ѓ\1[^_]fM0l\[^_]Ðt&V T$ SD$$T$E/R {Et&F8FZD$$OS fD$ 8D$D$$EYOUtt&$D$8D$D$D$D$ D$D$U-TU$ Dp9CPt$Κ CPCXt$CXC\t$袚 C\C`[^_]Ít&Cp$m> 랍t&'US]$>][]Q UWVS]C$ ti~1D8$> 9C $ C,$ C0$ C(t@$ C($ܙ ][^_]͙ t&C8$= 롍t&'Uu1]t2 $菛 SƋCFKFT$$L$B]u]Í&'UWVS,]Eti1;tt&E[^_]Ðt&$ Et&U(]]}uC $2t+~1D $9 9]u]}]鐕 C $u9 ߍvUS]t)St"u2;=vC$R fC[]Ív$0&$D$> 뺍t&C$뻍vC$-뫍vC$뛍vC$닍vC$xC$MhC$mXC$-HC$=8C$(UE]@<Ðt&USÃ@t$h$@ []Ív'UWVS&E$U ;tD$E$F tD$O$2 t$ b D$U$ ul 7 t&CtA93uuCW$T$LAuԉ H[^_]Ív{0D$$ u {D$`$q u\= D$Z$G u 2D$ D$D$$Gt O1E&U tP " uÍ&Ut Í&D$D$^$`9$b Í'UWVS,Uu}M u5C$UJC $蔊$ܑ U1,[^_]ÐuC SEfttStFBu@t%D$E $CC,1[^_]Ít&x8u붐t&C $fCCC t>C$RCuwED$C$.IS S^*vC$MR$Ul U$iJUCC CCC$IC&U(UT$D$@,$`RtTUtM1u0t  t ʃ t߄t ÐtƐ1Ít&UWVSL@XBpC@~0C0FC8FtC4L[^_]ÍvC4F C@FCDCD$D$ F,$wQt$EUC C,D$D$F,$4Qt 8?ED$D$ F,$ QM#}L$D$F,$UPME!ȉEԍED$D$F,$PUEȋE!C0C D$D$4$.C~x~s>0un}ۉt$D$ <$K D$D$<$-C D$D$4$-C0u̓1 4$ D; u C p>0gt&v.vU$]ux=ËE$D$Du$<]u]Í&UWVS,M] Zt@ t&t2;PuH;Ku@ 1D$E$A,[^_]Í&$<\$lj$DtYED$<$2;<$<E@tBt=D$ ,D$D$r$ (f <$;,[^_]ÍU܉T$@$,;EtG E$8{,[^_]Í4$ 苍 $D$+ ,[^_]ËC;EuE@@D$E$!D$ ,D$D$r$?(t&'UWVSE@t9tD$0D$$rv, $x* $09> MEEEEEA8XE؋;D$$}D+EEE{C4$tt]u}]Ðt&uZ'Uuu]}xdd1E󫈕tDžxE$tED$ t$EE UD$Ẻ$1ɍU䍅xOuEtM䍅xUE$vNx$x؋u]}]Ðu'U1ɉuu}}]uU tt U s؋u]}]Ít&U1WVxS] EDžxE$UEEEE̋CEBEBUE t,4$tnU$SMtĜ[^_]fMUC4$;E$ MD$E$}Ĝ[^_]fUWVS] u$ t~tW vtJC8 u@4$D${uߋC@P0uH4t˻<$L[^_]Ít&GPBMt 1<Ӊ$klj$1$D$뫉'UWVS]u Nb^ft2;PuH; u@ 1ۉD$E$*Ĭ[^_]Ðt&Džtx1׹󫉕dEDžxE$ U1EEEE̋EB"EB!UExtAx $NE$3Ktt U$Ĭ[^_]ÐUxMox$E$JU$릐$^T DžtE^Džtt&UW1VS]5t^FtQ t&tB9PuH;KuF$S VT$ÍF $D$FFU [^_]Ë6uu\$f$x$S $U [^_]Ít&U(ED$E]u$"D$ËE$D$Y $P ]u]ÍvUWVS<}E_5t~Ftq t&tb9PuH; uF$R ÍF D$FD$GD$$D$ D$D$D$<[^_]Ð6uuu|$$ER$R ËGD$$D$ D$D$D$e<[^_]Í&UW1VS<]5F t&tr9PuH;KuHVD$yQ V $UFt$U<$D$ D$T$D$D$<[^_]Ðt&6ju\$f$v<$P $<$D$ D$D$D$D<[^_]ÍUE]u$$c$D$D$ $qN ]u]Ðt&UVS0E ]EtwD$E$(" U1ɉD$1D$D$ D$$hƋE$ uEtD$$ƃ0[^]Ðt&tt 8w11눐U-WVS]u}twKx~;K }yu"D$qD$$<t K뼍|$ t$E D$D$t%uSS[^_]Í[^_]ËK먍t&'U-WVS}t>G1G &9w ~%{uC$1t[^_]Ðt&1[^_]ÍUWVS,`}1t&95`~ju{uC|$$/0tӉ$=W D$D$$E"UT$$95`&,[^_]Ð&UWVS,]E-tg$EuX5trKx8{ 9}1A;ttGT (v9} 9t+yC$it'EE,[^_]Í&C4$5"tА܋CxA9C f~: uD$D$$<tP҉ЉSyE뉋D$!uCfU‰WVS1ۃ,9Z ~t&~t"C9Z 1,[^_]ÍvD$FU$+UDžCt4 vx>uD$F$+ލ&'UWVStEX ރx5 t&x ;uD$C$U+y[^_]fU]]u-u]u]Ít&Cy]u];C }f1uljuCu&뜃uD$)፴&'U(]]u-}tbf1uU{x;{ |{x];{ f}Vu.t4uE D$D;$<3Ɖ]u}]Ít&ߐސU]]u-u]u]Ít&Cy]u];C } f1uƉguCu뛃uU T$D$k1ۍ&U-$t$Uu$t$]Ít&By$t$]Ð;B }X4t0uDE$t$] $U1UtBx;B }<t#ufBx;B |1<u݋D$* tÍt&UWVS]t^Ђ~]Ђs ~01v9{ ~~uF$9{ ][^_]F [^_]D$ D$|D$<$NUWVS,$H E@`(1}1195`~b8u{uM}K}G EO $D$UGUt-}95`t&Ex EЂ,[^_]ËM $}E EE,[^_]D$ D$YD$<$a{&UWVS/4$)G ۉu!vUԅuEV1ۃ=ȂÅD$4$*ۿUt&UE <$O D$D$$i\$t$$4$-D <[^_]ÍvED$:$at&u1>/D$/4$6B4$D$ ƅD$i4$ D$ ED$D$$&<$1ۃ=Ă&M1$ L$fD$/4$D$4$?t4=̂û4$KD$4$[/4$x EMD$ $ t$$Eԉ$ Mԉ $ׁ &ED$E4$D$B%B`'E UMƒMǂǂ`EĂ1<$L D$D$$\$t$$ht&t$D$$/vȂ1"&U<$UvUЁWΚW{E$,D$=E EXM fD$14$!$?4$踳tqsÉ<$$D$D$P$v\$t$$rt&t$$A4$s <$5tc t/$1Iu t$ D$D$$m GD$D$$t$$Ívt&'U WS@U eE1]ЉE E܋BEBEB EBD$ D$\$EE${Ue3u@[_]vU WS@U eE1]ЉEE܋BD$ D$\$EE$ Ue3u@[_]It&U WDeE1UЉET$E D$ D$$Ue3uD_]t&U WDeE1UЉET$E D$ D$$LUe3uD_]UEu1]ft]Ðt&UWVSÃ,UM$o$? \$lj$&f~$I$j? \$Ɖ$.tmp@$?j4$\t@U$@Et+EU:0,1[^_]Í&4$p UŐ$D$D$ƭ$\$t$$4$< <$< ,[^_]Í&'UWVS<}EԉUE&D$|$EЉ$0C8 t׉D$Eԉ$xC8u@1t <ۃD$Eԉ$\ D$Eԉ$\ D$Eԉ$\ \$Eԉ$\ M$f1<[^_]Ít&$F D$C$D$<[^_]Í'Uuu]Ӊ}EMt)T$ D$D$$h uF\$ D$D$$h u]u}]ÍD$D$|$$ D$D$$UT$$D$D$$y\$$D$D$$Q$KED$D$$D$ g UD$D$$T$ g E$ǬU$T$EtȚt!UED$$T$uED$E1$;1$U$HT$D$dZ&EUD$$JGf%$?U$$T$D$ ED$ $ D$D$$$U|$ %\$T$$E$t US]tDC C$m 1C CCCCC []D$ MD$iD$$X.v'US]tBh~?hC0$7 C4$7 C $m ][]7 v[]D$ D$D$$NUVSÃJ%t+ &t;Pu;Hu[^]fÍ&$ 9 PVPV [^]É'UVS]u t7K…8u&$8Q9 1҅‰Ph[^]D$ D$D$$vUWVSU EMe]1ۉUUEL} ]11Džl1ɉDžpDžxE; w$DžpCt $9uw̉x׉lUR҉U=MqY I EMY"lp6} DždEGE@D$D@]E{u}C MQ  UB$q MA -YD$D$b$\$$]ECUe3E [^_]Dždtd$@un E11۹8J$#C Ep05\$4$!EE$ UDž\DžPDžTDž|4HE@UET$UMD$D$D$ L$B $9EPEčPaX t&EDžtE]%M]ELh`]U E-Lt ML l7}EPT}‰HX @B|M}A$#\A(Mĉ $轜H$_f$Et&YtL'vUhu4 #E]E$9]E1ۉ$;M u4 봋]$MA ;EuA;Eut&uUB;EzMiM]IMs ;'PhMC&E} t] ]}fU1ۅt@U@tu)p} t31:Mt* tt 8@u9w97)]Jލt&kD$ D$$9U1۹8X pEȃ|ۉtxdt pEE]ĉ$M]Dž\Dž|PTpEȃ|ExDžtEUED$$DžtEtED$$U̍MЉT$L$$!Ẽ]ЍUt&9uE]ȃ\E]Džtg`1ۋ}t&FtUML$T$V$Ѕu $9w;]]ĉ$1菘rPUTl $\$zEE4$- UB4$- $0 MA01щ $/ t@u'u t,@tu u]K4CDždDžx}tU9;>u+]Ut$\$$t&mt&< v< #f_U̍MЉT$L$$Ẽ]ЍU9uE}UEP}t&Džl1DžpDžxEttt t{E8H%]P;S t~AM08QL4MhuM8tߍ]C $` C CCE$;H<_1у9EL$t$$]dC=p dȉʅtzu]9tfBȅt^xu x]ht$\$$#D$ D$D$$`p\C1t+,]ECChqD$@D$U$D$ *D$D$$ MC'U1UtD$$Ít&Uh]ӋUuƋE }M̉UĉEEED$$t]u}]É$@e EEur}(7$D$D$ݭ$Jt$\$$FE$( E܉$' nt&E$M܉؍UE}NRt}tŰEMMEЉ$\ 8O$$\$$2D$x3vE܉$%h8$?8NjE$E<$M ]ԋ]Et&UD$T$$GD$E$itɉ$1 D$G$D$E$`] vEЉ$[ (E$}[ t1$$Y$2D$E܉D$.UًE$UEUD$ D$D$$*<$0 \$$HD$ E܉D$EЉ$Z ]E$w\ RfEUĉMD$.D$ET$ UD$D$$)Mu}UEЉMD$ :D$T$$)M1$/ U\$$,T$D$ 3ED$ SD$D$EЉ$)$/ \$$HD$ E܉D$UЉ$Y ME܉$Of$W END$D$$@\$$BE]ԉ$MY nf$$+\$$2D$G$D$D$ƭ$t$\$$D$ zD$9D$$e&UWVS<] }t E GtU$_ EtNW GT$D$U$}^ tqG $oD$E$3X <[^_]Ð_ D$D$b$\$$<[^_]Ív$1$ @G,$EEEEEАD$ D$\$E$9(hW,JO, t qk u>MtUB8$CCEbf$0U܅҉EED$U܉$ptAt<t6t1 $O# @vEE;G$űUJÍv$xD$茋CfEpSBPKI Ȉ&UЉƉ$E܅1M Ut ; E܋U $$k U$U <[^_]ÍEE;G(UJt&$ C+ $PD$CEЉ$8bE܉$$m$ U$*U G EP:3C@&JC@ ˆt&ƉW,cU(]]u}C{,u!D$$uys,C $kT C,1ɋSC D$ s{ t$|$C$uCCC ]u}]Ðt&$) $D$D$bD$J$2fUW1VSE d1tX$Pt suu/dt%v$ tK ttEᐉ[^_]Ít&D$C$Ub C utfdu 묍t&t$tS tC$ a uC ύ&CD$$볍vs4$d C t$$CD$$vUWVS hu} du/&t"Ct$$[tE1[^_]Åul4$$ t$Í@$1lCdCC ҉CdtE[^_]É4$0$  lD$D$$ UWVS|eE1EEEEED$$U ׉U1E D$$ljE1EEED$ D$D$$E V3L9Et$jP EUE$U$E UE$ EE-U t E$MUE$3UT$$&}Gte} D$D$$lt& Pu<eED$|$$~[E?tG8t?uUE[CEQek29UuU uhD$D$$UT$U$T$u u =t8MD$D$<$_UT$U$T$MEtM$`N MEtUE$EE$ EE$ }EEt$O E$ E$ E$8D$$$Ue3g|[^_]ÍD$ D$u$cD$$`bfE$  EE$ E2&1D$D$$t$$( vBU$Ut"fB$}U]փ${" $D${lj$\" $D$\o$$W$D$ED$,?fUWVSӃ,t>ut&Su5t$B$$D$7uɃ,[^_]Ãut&&'U(]]u}C{,u%D$$s,C $wK C,SC M D$ s{ t$|$C$"u-KultU CCC ]u}]É$ $D$ȾD$D$$*v'U(]]}} usttC $J C D$ D$D$C$;uSult]u}]Í&su3{&ːUWVSEuMXT9PE$w F+}+}GV$D$D$藹>D>U$T$UT$ټME } $D$M>$L$D$讼}9EuN$>$薲lj\$t$<$D$ l4$ [^_]f$` $$$踱D$ f D$D$ $ 蔹D$ f D$D$ $ pD$D$$cvUWVSLu]k} nV{Ct$m=_4$t9U <$$述Ét$M $~D$ |$$D$L[^_]Ít&ED$ED$4$ۋ}ECp$Ul|$UԉT$D$ Et$D$E$RLÉ[^_]Í<$H$蠰L$D$D$h$˸st&E xD$ V D$D$ $* 蘷t&$pD$D$<$V\$1ۉ|$$PL[^_]ÍU Bd)E $:-vM A`t&D$1D$$$Ot&M $PD$ V D$D$ $讶v'UWVS,E uPN҉UuD$L$$zfQ;U}߅fE~]11҃t&49ufUڋE܉$ E@UE+BEsED$D$$=1҉1&;E|Ht|\D$D$$1҉Ǎvu$<$l 11;E}<맍&;U}׍8u Ɉt볋EMt$L$$Ʒ4$  uED0UMڈD1uEN$D$L$肷EڋU^fMڈL;]uiu܉4$$ʬt$D$ ËE$D$-U$r ,[^_]D$ v D$jD$ $3 xD$ v D$D$ $ TUWVS1ۃ,u~$wFD$D$$5uED$F<$D$vF|$D$E$rftvD$D$9 $賴$D$F<$D$萔uD$D$$sD$$/&EE,[^_]foUEH ]Ít&UU‹uE ]É'UVS]Eu ۉu fH;u!‹u2[^]Ë0[^]Ív2[^]Ð&UVUS] M9t.1t(tr9t9tu[^]Í&t&1鍶UESU t:u4ft&t.H 9tt uH Yw䐍t&1[]ÍvH t tu1␍&UEM u tP9 u]f UEU S]t tu[]Ð@ t&tufUEt@u]ÐUWVS]M ut!ɋ;tt9u v9tЅu[^_]Ét&t9t[^_]Ð9t؋ ̐&UWVS\]u0GvL$ D$莵CA?w D$C D$C\$ D$ D$D$L$+S x?t&bBxT҃mx0縃vx(漃rx$ɃɃeMH MHUD$$M賳U܋M|$ t$T$$UԉL$D$ LD$P T$UD$$T$b\[^_]Ít&rLD$D$$ D$ TD$ FD$FLD$L$~,羃p~@Ƀḃv~0҃⼃r~4|$L$ɃeD$ LT$D$ D$$褬!vBP T$PT$@D$, D$D$ L$ft&BPT$D$ D$D$ L$/UWVS}u t;1&Ët(9u;t@@ tt5tuۍv[^_]ËF$mrF$ ʋ뾍v'U1WV1S}u 5ދt-S t9tDt#ttuӃ[^_]ÍvC$qC$b ŋ37뺍v'UVS]u?&ttt%C 3uC$qC$ ͐t&[^]É'Utt1t@@@ @Ðt&$ fUS]SPS P []ÍUuUPÐUx]ÐUSÃ@4t($D$C4$ []Í$C4[]fUSÃ:@Tt3H41t#It<$SD$C4$[]ÐH4uω$)C4D$D$$ #vUWVSÃ|C0 eE1ɋrx $4 T$C,$FU$ U҉HNHN PH KHCHu-=~$D$D$$蹫$<$oEe3|[^_]Ðt&V JwK,Z&Jv܃=ș4F UUD$FD$$D$ D$2D$D$iU$T$ t&4$蠟D$D$ $EŪUT$$Mt&~}$4l 4$C,D$KVvC,U$2 UC,-f&vNtu4$~ixt&Uh]Éu։}zrH,tCD4$m]u}]fGEЉ$akEt|G$0EC0t u|$4 T$C,$C^C,$ C,GfD$D$ $UԉT$$+JED$GD$ ED$D$D$D$$]‰C,EBOB$d&D$D$P$,|$$,C0ED$D$ D$D$($UЉT$$?$ C,ɍAv3MD$D$$葧MȉL$$莩PGED$D$MȉUĉ$gUĉEԋBD$BẺD$Eԉ$XED$D$$aEЋMȉD$D$EԉL$ $YEԉ$bMȋUčABO w:tUЉD$T$Ủ$MU$zUċBD$D$$ UWVSÃleE1ۉU.Ef{C $Br$ C SFT$U4$bU$=4$E4$ED$D$$E̥M|$L$M$L$ ML$U$LD$D$ $肥E趥U|$ D$T$$<$34$cCtEąsuEe3l[^_]Ðt&$谙D$D$ $EդU|$T$$4$&cCkfCD$CD$ -D$D$D$EЉ$ЩMЉL$$It&$H D$D$$.t$$n荧'UWVSÃ\=eE1UuKsDD$D$$蹣t$$CHCH1$)v 5uws,IUt$B$D$[xǃtOs$' <$/ D$D$$t$$C,$EC,$HfC0$* Ue3\[^_]Ðt& D$D$ $蚢$ޤ$l =~$D$D$$ $[$蟤UBx $!  C,@D$EċC,D$ V[D$D$D$Eĉ$@{,W~D1Uĉ$yT7D$ D$EĉT$D$${,9wE$5 D$ˣU$4T$X^v5L'D$D$x$:$~K0$4nT$C,$;s,f&;D$D$$諠$询$" $w }=H<$,bD$D$ ‰U$OUT$$茢1D$D$D$T$ |$D$$6UC,@|C,$C,}$ at;=Hu=$s<$baD$D$011҃=uEUEUD$D$ $RD$=<$莡U赢UWVSÃVt+$U輖D$ :D$U$T$xD$z\$%D ?z M! , ~ t T$ D$ D$$[,/ f$ D$vl[^_]Ë5,z7Uԅ<$贇<$EG$蛃Ẻ<$0< t$1T$UȉT$ỦD$ L$D$ T$$EԅtpCt+& tGBu܅u'@x C$ D$EЉuUԅ=8<$D$D$/l[^_]Ð,r E؉D$4$F$&4$EM܉MȉEċE؉ENMԉ4$轆E UuA T$ UĉT$UȉT$ỦT$UԉD$ L$D$I T$$胏1} t& Cuڅu"@x )$ D$託ډ[붍t&t< ,P RcD$D$ $ǎC+ ,-$ D$,u8v,B P1tD$D$ $8&f$ D$蛖f_( OD$& $ڍ<$D$D$5 $蔐\$$D$蠍D$$茍'$ D$ <$ȃ<$.EG$Ẻ<$Du/t&E؉D$<$豒MԸ/t1UЉB@ D$D$Y$֌MЋA@G$<$?M܉‹E؉EGẺ<$UM蟃t$UT$ML$UȉT$M̉D$D$ $L$ [Eԅt52$:D$t @8 12t&D$D$<$+mv4$؁4$EݎEF$>~Eԉ4$賂E MuA L$M̉L$MԉD$ T$D$g L$$舋$ D$=8D$t$$*t&tB ,>H ID$D$ $UCUUZ,ҋU)$ D$UUU8D$t$$A*9&$:D$D&"v$ fܑv&vD$ uD$D$ $C,t&D$& $؉<$}D$D$) t&$:D$/UvD$$(p v$ D$ 8^@@D$ $D$(=&$T$蚑=$ 蘐&D$ uD$D$ $UňCU=uDED$F$já,D$ E\$D$$$/&,<xD$ FD$ $D$.D$<$<$hT$$芐4$Y}F$UyU\$D$ $T$D$ 躇D$D$$x D$ Pj$贊MD$$E45"%` U؉T$@$؈E;F,E;F E 1D$D$<$&FD$ FD$R$D$谆Y<$D$ $D$苆- tG!t&$:D$ڎ$:D$^?DU؉T$@$請U‰WVS,E@Uz(MA $Et.Í3 uC$mZu)[uڋU$MA(,1[^_]ÍvC$$$@x @C<$D$VE$Ur( t$<$"+ tCMQ(8tBuB,[^_]Í&$EP(֋R(ыMQ(D$ :D$D$ $ 蓆 UWVSӁ eE1Bɋ@DžDžOF4Htha?D$1D$$$Me3 :Č[^_]Ðt&Hu싕B$R+}$+{6 A $ڛD$D$$,|$T$ L$$X1ɍډ$|$ f DžuDDžA@u.DžBu҃⾃Ft&11ۉ $oMBD$B $D$ D$2D$D$ 11 uSur獶D$1D$P$辄$t&H v~Ht?hQ:\RP:F1 fP:u u9$tkQ:P:?R:P:u?Q:A $D$D$ $lT$$覅$w D$D$$|$T$$MBP@P0P4P,PD$4$EC@D$PLD$T$ D$$6C@D$PL$T$膣 @ D$D$C$T$$>$0 8 $D$xD$T$ $:~ =C8 u@pu=F0 C@D$PLD$T$ D$$C@D$PL$T$ÅOA*D$D$C$謀\$$tM=tDȀ$ D$,賀D$D$$Y\$${脀$ D$$@A$过&w1C+C8 u@H0P4x,oHtD$t$$)0C@D$PL$T$RD$D$$~|$$8<$0 C@x0MH4D$D$L$~~|$ D$xD$$,{0@ $0D$D$ $B,0D$D$$00 xЋЉD$ D$D$ $-=0y <$`BNDž&D$|$ D$D$B,$蛉D$D$$|$-}t$|$$|$ D$a \<$N DD$$[-4$Tƅt& < ((n=t  D$( G D$$GD$ GD$GD$GD$GD$ D$2D$D$E$$T$i E$T$J<$RD$D$$8{\$$8}I@$裐D$D$$z\$$9}B$"QAl<D$D$A$zD$D$0$zt$\$$|}D$D$$i,MD$D$<$F(A˃8 ut&C8 u1EP$cD$D$$y\$${)D$D$_D$D$+D$ D$D$<$*)y$ D$|""D$$-ډL$1ɉ<$D$4$)$$Ë$D$}L$6D$D$i$]xD$D$$:xC@D$ t$D$P T$@$D$D$ D$$D$$D$D$$wD$ D$D$$ UD$ $6 -<$11ɍډ$|$ M|$(B D$$BD$ BD$BD$BD$B $D$ D$2D$D${$D$o 4t& T$ډ $1AMЉT$L$$av1D5Ѓ<$D$ D$D$D$){9wɉ@yQI@p 4$詌|$(t$T$$L$ <$D$T$L$D$ D$D$sz1{LэqtA1D5Ѓ<$D$ D$D$D$z9wɋ$L$ xt$ D$2xD$D$_$ v؋u]}]f$@&Äu1-D뿃 t t vt t=t F FсF ."t&&u? VV V&Ѓ)ЉF F F ,91    v F 늍t& fu  t&T K B7 )f    f==V 0ʃ)ʉV F13%Fct&@?=w$tt& NV N&^~9t:D$D$$b\$|$$d`u 0 fFFF v& NV NN~ f ? FF1Z ^F1? ^F1$D$D$L$a\$$cN^f1[t&'Ut&UEtt ҉tfv'U u$OÍ'UWVS,u ]F$膻E~@w{ǁ0 @wQ{Sǃ< @wQS?@wQwtMtE,[^_]f@w0@wQE,[^_]f@wS0 @wQS<@wQE,[^_]fU8]u}w]u}]ÿDu܃D$D$Ebt=șPu `< t< t< t< t&tu1E$UD$eUt*u؈W@< tF< uB뮈=6D$D$J$u^\$$` WG뱍&UWVSLE܉UL$$3D$:U$J[=ș@< t< t < vE=M܋qE$p_EG<ulUMAEUčv]؅E܋U P$L[^_]Í&E@H1L[^_]Ít&uul8u utxutgD$D$$\$^D$ \$ED$L$qL$ D$*b0t&L[^_]Ívx dD$D$U$6\$:^LD$ t$M$L$pL$ D$av< < Mċ]At$< t < t<,tʐ< t~Uĉ+Uă щU~ u9ɿr}M~uĿ|9~M~uĿ9MuĿ9toM~uĿ9M~uĿ9E~D$D$Mĉ $G`u3M@Mf< tT< ftN<,t`t&t|}u信MܸA L[^_]Ít6< t< t<,ut&< z<,`mv1]MG&]ċUăBӐM'&D$D$]$Y$[LD$ \$U$T$nL$ D$+_MD$D$$QY$U[MzM qU$$afUWVS1ہlEeU1҃<@DžDžE +=x(th\w[BH9BDvMڋq< 9GDv/  GHvux@(Dž NFHD$ T$L$4$6NjxDC@@ψC@D\$D$$X@(@@HDž NT$L$t$ $hɉBDtR<T}21߉FFXFPFLue35 0l[^_]Ëu@,r<>-B 1҅v |> Dž4I4u/IHD$)Ή|$4$FHFDt N< FDN< HNDN ?Q AH1~-~-~-‹A bD$D$$S$1VLD$ |$t$$ThL$ D$cYDžB It&kfjVDžt&UWVSÃ|pX@P} UMESLUK@1MKHC<;KDEEuKS$'O$+Q1^t&SH`<$U" Uxf$" MPɋ4x& UE U UE UxUmt&CVH9 ]1] ;VDN<  9ÉVHEw݋]̋FD9FHE9EvJu&C0C SS(UB9ƉEvCuS(;S,r̉$謾uԋEUɉM̉ẼL[^_]Ít&} N(VV@NL99uU$@wD$UnU}0$ @wEu؃u}D$D$"fڍt)ډU륋M؋$ ,;EtQE}8t>Ut: } t%|$\$$u}ub1L[^_]Ëuԅt3M؋} A!At}؋t6&U؋M rB tՉ$D$D$"$)U܉T$$+1ng]11ڋ:tz tу9s΃߃u;t`C tTD$D$$!)31T$UD$ut$D$"$DD$ &$0US]D$D$#$(\$$N3t 1[]fD$ #$tD$#$tD$-#$u 뵐t&D$1#$hu 땐t&D$6#$Hu rD$<#$*XD$?#$tD$B#$tD$E#$ƒtU8EU M]]U܋Uu}EMGGuD$D$%$U/'U؉T$ U܉T$M$L$^)D$D$H#$&U] u]}UE]%)t&kD$D$%$U&U؉T$$(느&UWVS|E eU1ҋ]DžDžDžDžtT$$(BtT$$$1e1111tlu/<$\$~<%tuN9~a7D7ΉAufUe3e|[^_]ÍvN9$t&1VBJA$40fN9%D$BvF97%D7t&<$1{D$474$D$D$ -D$D$X'IL$L$$"D$t&AT$$[ yAx0H u @$$|@ $ D$QDžDžDžDžDžDž $#HA?L$L$$NL$$c#)ED$ $D$j H#t&USUtr$6D$D$%$\$$ "D$D$$$D$ &$![]át[]ÐUSEP w t$[]ÍuE[]2f$nD$D$<&$\$$D![]Í&'UEnv ÍvE UEU tnvÍv=șuU Et&'UEnv ÍvE U(]uu2]$!U11УE]u]USEP w t []Í$fD$D$p&$\$$[]ÍUSEP w t<[]ÍuD$D$&$+E[]jf$D$D$&$\$$,[]ÍUWVS,uED$D$4$4$1A}1҅t  9uf%lj$Zu,7[^_] US$EEEEED$$~tV&t:t5$1D$D$o#$\$$v$[]Ðt&$1[]ÐUH]]u}u-=̚u#$Gvt"tt&]u}]ÍvD$$l&5: u$$v@/sha@re/g@ nupg/usr@G/opt@ions@.skef@ lD$<$$L$d\$<$0/gpg@.conf@f$?<$:$EiUԋ$|D$D$ƭ$>\$|$$z4$6f}]u}]rt&D$D$'$\$$0$D$D$ݭ$\$|$$yD$<$E$U1}؉EEt&<$t"1 <$uދE}؉$+4$#D$D$0($|$$7E܅D$D$X($|$$&E$D$M t4}2 )  #t&t8E fE4$_ bE$?D$D$ ($t$\$$UH]]u}$Ƣ$jD46EԹtduԿ''tSuԿ,'tBuԿ1't1tdt6'uR$UorUDt&$UUrUD]u}]EH]u}](rD$D$<'$\$$ 1믍UH]]u}$覡t1ۉ؋u]}]Ð$<vߍD,'EԹt*tt6'tuԿ1'uf$UeqU1|n)4$ūtr$$uKt(D$D$P'$t$$M u*4$nt&$أg1אM t$\$ $vU8]1ۉuu }}t؋u]}]ÐD$D$n'$8$ 1$o\$D$ ND$D$Ɖ$S$Qt$$'ÃltQ4$m;<$mF$nE9ft$<$D$ %$&F<$D $4o|$\$D$ 'D$D$Ɖ$6t&$1lY U(]]u}$t]u}]D$$uڿ tʋ5 u $u t1fD$D$'$p\$$ Jru9D$D$'$?$'D$A$=bIUWVS,}E$t1۾5E1'$b$m} t} ,'t46E$D$VވP6t&D$$8$k4$/tÉ4$#  $D$D$ƭ$EUt$T$$E&4$jE*$jt D$ D$D$$E,[^_]É4$؝UEtD$D$'$6t$$vEq$~tE EXD$D$'$$E" $ D$D$ݭ$\$D$'$EU?Uw)]Ít&UU Et H HJ@]ÍvUEP 1t St ƀCt ƀEtƀAt& =u]Í'Uu(UtCu U&t&T$D$ D$D$$É'USÃ4҉UxPE$P T$PT$@$D$ (D$lD$D$\؃4[]????C-??-fC??C 4[]ÐUEP tɸet&D$D$($fUEPtɸ %t&D$D$($XfUu(UJt@u UL$D$ D$D$$dÉ'UEPtɸt&D$D$($ fUEPtɸ-Et&D$D$($x fUEP = 'U(Eu Et&@ D$ D$D$D$$iÍ&'UEMv'U( Eu Et&D$ D$D$D$$ƊƊ UE] v'U(Eu Et&D$ D$D$D$$ՊjՊ UEP`T$@$fUEPpT$@$dfUS]Ct[]Ð$lfS҉CtK$T$L$#CfS$T$SLT$#C뮍'U(̙Us7BD$ -D$D$D$$m`mÐt&tctD$Y)D$$(Zft:RD$D$ (D$T$D$$mmÍt&BD$ (D$D$D$$mmÍRD$D$ -D$T$D$$m{mU(E v" t5D$H)D$$(i rރ $ÍPH H H ʉUPH H@  EU$1Í&(ÐU̙t?r-t#t&D$`)D$$( f ÐÐÉ'UWVSlu ]F$E~ɃFptM$MC;C9D;CC`T;CCLH;KK5FD ;KK~D ;KKD ;KKD ;KKD K~w7V11;KDD ;KKYT K9KFD }Ku Fpt$9l[^_]Ð~19KE؍U}ȉEUt_UT ;KKBD KMT$$D$EaE$_9u~K9KuD$D$$1K넍t&2E1UȉEE]ӉE΋DpU$YMU\$D$Dp$xMU9}t]֋C;CMD$D$$CMD;CCMD$D$$UCMzfED$D$$-KEf+E.‰Љf;K'&}ȉ|$Fp$MMȉEED$D$$KED$D$$KEȉ$D$ED$zt&D$D$$XKD$D$$8K\$Ɖ$4$X]u]ÍUVSÁ@$w1t=S CUExxS|~1ҋL`Lp9uQĐ[^]Í&UHuu]] }~ wMF<CCC E0؋u]}]f!WD$$<$E$iEԉt$$D$R<$v농t&D$$F$.~uUT$D$F`UЉ$LM<$L$D$EẺ$+[UD$T$Fd$<$ƋEt$D$\4$Z<$\D$<$PSPS@ C <$t&$\gt&tSCCC CR$T\it&$@\$-\D$ )D$D$($(9t&UHuu ]]}t_C(u@K,u9{ wSCPFC,C( C,F]u}]Ívu뜍vtD$$cP @  A A ‰AQ Q Q ЉFEԉ<$EԉS(VS,h$1tt$C`$NS(VS,6&'US]D$$(][]vUHuu]] }~wMF<CCC E؋u]}]fD$Eԉ$NjEԉ$!$~T$UЉ|$$G O  O O ȉFDGO O O ȉFHEԉ$dU>t&D$$F$~uUT$D$FpUЉ$4M<$L$D$E~Ẻ$WUD$T$Ft$<$ƋEt$D$D4$V<$DtPD$<$PSPS@ C <$Z$X't&$tXf랍$E]XUЉmD$ 4)D$D$($(c UHuu ]]}t_CDu@{Hu9{wSCPFCHCD CHF]u}]Ívu뜍vytD$$P @  A A ‰AQ Q Q ЉFEԉ<$EԉSDVSHh$1tt$Cp$nSDVSH6&'US]D$$D][]U]]uU}} tj`1 T$4$E D$u"\$4$6C]u}]Í$(d1CЍvB J  J J ȉBJ JR  ЉC눍v]@UU t ]Í&=DtL]ÐUESMU w$)&v;v1[]t&Í&v#YA AI ȍD9tɐÐtvt&w֍ҍu뾍t&rf릍t&Zf뎍&'UWVS]u $T@?C $kTۉGUGXOt19u[^_]Ð&UVS0]} F;C usC8@D$ 3D$sLD$D$4$Y !%tꩀu)S0[^]Í&SD$D$ /,T$sLD$D$4$듍UT$UT$$rtFEuD$$t$D$ K,D$렐t&CD$ 3D$t&sLD$ e,D$D$4$i D$ +D$)D$,$,UWVS^ ~v } q9Yf uUM܉BE܉J <[^_]Í&E$3E1EÉ'UWVSÃ,pu @(;C,$:jKu C(;C,$jSuC(;C,rm$iЋCu0C(;C,s(K0C S C(, [^_]Ív$UiU,[ȉ ^_]Í&S0C SC(뇍S0C S<C(GvS0C S4C(t&'UVSÃPu@(;C,rW$iCu+S(;S,s#C0C SS([ ^]Ðt&$h[f% ^]ÍvS0C S4C(뜍US؃u uƃ[]ÍD$D$4$X\$$ÍU]Ӊu ƅtt5tht$ D$,D$$u]]fȺ*)R9t;$ D$ruD${,D$$O뚐L$ D$u,D$$+MfU1WVSluEtEE]vUJBUELt&MeE}9}}!} u BM 9MV Mԍ)qPuԁtdv }Mԍ@P;]woEiuhv} Et1l[^_]Ðt&~32Z rRM ;]ԍPv&5R]tU1l[^_]ËE Eԍs9wMЃ' }Pu1M1CE81} } hručsE,,#t$MЉL$}D$ D$,D$|$$UU9uz} Mи"d w5fD$ D$u7D$$UMԋU)ٍv} a}TE1Fv੿FSB,4Hr @ t q{fuM$T*s\$D$ D$|4D$$UUJMą,EuifUUt&$ 6ED$T5D$D$ $7UD$ D$$.D$ U7-UBM ME EHp@L$t$D$ED$5D$D$ $UUfuD$D$$~KD$ UD$ )t$EĉD$$&U멡D$D$$.D$ UMUv]1]1UĐD$0D$D$ $9rҋ]ЋU/D$D$$.D$ UU]1]1Uč&D$0D$D$ $\9r{D$ D$$D$ UY-UdEx@ NjEH@ DEи-;u/uġuЉt$$D$ )|$M$=D$uĸ-UM>D$ )L$uЉ$t$HUEă$UMĉ $t$D$-D$D$ $UtD$D$$9.D$ UD$ )t$}ĉ$|$U$D$D$$!.D$ UU]1]1Učt&D$D$D$ $T9ws.D$ D$$.D$ UGUp]1]1UčvD$,D$D$ $9wv"MăD$[.D$D$ $UD$ )t$EăD$$JU,D$ D$$P.D$ U_U]1]1UčvD$D$D$ $9w <}ĉ<$UvU7<$c$;D$,D$ D$$Uuĉ4$U$D$,D$ 붡D$D$$-D$ Ua-Ul}GD$D$-D$D$ $UUЋUăD$D$D$ $9rϋU D$D$$-D$ UU]1]1Učt&D$0D$D$ $<9r[D$D$$v.D$ U9-UD}GD$D$-D$D$ $UUЋUăD$D$D$ $9ruĉ4$UU4$$D$e-D$ Mĸu9u,D$ D$Y-D$$UU^ -8uFD$D$t5D$D$ $UUMĸu9u,D$ D$,m%-}D$@-|$ LD$D$P4$UЉT$$f;]\MtuEЍr\$4$D$t Ut}̋M9U$5T$*1D$z-D$$UUuċ}NGvD$,뿍v'UWVSV$F V$ U(ED$D$ D$E D$E$ U(]]uu }}t$|$C,$t]u}]Ít&}}u C0u]E]cvUX]ÉuΉ}vh@uK(;K,rqUЃ$KXU%tsD$T$$,65t$$D$X]u}]fT$$.ĐC0C SK(u{u C(;C,T$W%E؋Ku C(;C,$WSu C(;C,$cW%E܃w1t)‰ЃU$>‹EPM؉zJE܈BE׃ E׈EtG1ɉ}ϋCK(;K,C0C SK(D: t~Ë}}t2KK(;K,C0C SK(BMJ}tNE~G1ɉ}ϋK:K(;K,.C0C SK(D:t9}Ë}t0t+UD$D$P6$$,UА1t&T$$.yS0C SC(U vS0C S<C(S0C SC(Uv 9|$$.&E܋M؉|$UЉD$L$D$ D$6D$$}UЅ+D$=bD$UЉ$]}1D$/D$$4UЉuމӍD; D$,D$D$ $uҀ}ډu1D$=bD$$t&UЉ$SUt&UЉ$SU!t&|$1$ 0UЉ$SU(MD$ /D$D$ $'URD$$/D$ЉT$JD$ $D$ +D$D$,$/v'UX$]Éu։}O: ‹EPvjKuK(;K,rsUȉ$RUȍHBvot$D$$,6|$$D$'S]u}]Ét$$.cƐC0C SK(널؉UUȉUȉBCu K(;K,Uȉ$QUȈB B 5SUȉ$%UȃEtb1]ЉӉu̍ED$EЉ}D$$m+}҉D 89uű]t& t+B UD$6/D$D$ $UB UUB 1C0C SK(D$Q/D$$D$D D$$赴$ D$TD &JL$ D$L$BUD$6D$D$ $UB eEUWVSÃ<E$ʽEԋEP9s5=D$t$$P<[^_]ÍEq19t&C0C SS(9uE;EE4U<CuS(;S,r$^O%뼍&L$ D$Y/D$$f}Et$ D$/D$$M }u$EC0C SS(t#CuS(;S,rЉ$Niuݡ$ D$CfC0C SS(,SuS(;S,rՉ$UNu몍f= fF $4NjExSuxC(;C,spS0C SC(UBpztf C0C SS(tDCuS(;S,r҉$Mfۍ$M$q/CPf1UWVSÃ,$;4EtDC0C SS(t!KuS(;S,r҉$MuߋE,[^_]Ðt&UWVSÃ|EeU1҉ECuC(;C,r`$LЃ#tjBE|$T$$,6D$t$$$MHfS0C SC(#uu D$1t$$L}e3= |[^_]E 8؉UNUMEE/EEKC(;C,K0C S C(Mutm/t#/t/t/t"MD$ T$UL$MD$ 7D$$L$ML$UE EĈEU}MG}MxHM P H UĈP0M@@HM $}<$E]Eu hE}6E}@Ek1MЉ]]M}f9}lUEuD$$D$+uЅ҉D`t|$ D$0D$$D$D`D$$$ D$D`a|$$.&D$/D$$?unt&$T$"tRSurS(;S,sjC0C SS(PZvD$ D$/D$$u1D$ D$$v$H%v뙍U$HU%Et&MAMMHMHM P@LHU@(@!@ P@M@D@Hv}}O~]1EЉ]ˉE}UMuD$T$ $+uЅ҉Dp9}}]i1bf}]RKS(;S,C0C SS(MA4A5PA1AHUB< B81҅}<O8GL9&|$ D$q1D$$D$DpD$$$ D$DpvETt&؃vUufiQEEEEpt&؉M1t$1$D$LMAp|$ D$/D$$rf1t$1$D$UB`d$E1E@1UB8--}t Uz1PE9EU1M}D`ǍvEx1jSC(;C,S0C SC(CCK(;K,7C0C SK( @JȃMU$+UEMQʈM}׉u1vC0C SK(CuK(;K,rÉU$pDUȍvMЉuD$L$$+uЅ҉EU9U}؃MfAx 1D$ D$_1D$$Cv$Cg1 hUġD$G1D$T$ $3=E9ED$0D$D$ $D$D$$,$ D$$11JU$BU,<A5{pS(;S,dC0C SS(}G4{-S(;S,!C0C SS(UB8{S(;S,C0C SS(MA<}}G8ecZ-=M1A4}$}11E$&1։}E+U$T$D$EGLEf}083D$D$$ ExLtJ]]1uƍ&;D$,D$D$ $FL9Ћu]$ D$MU}ALM|$$D$aD$ D$D$L7D$$P$01'D$ $D$q}MĉD`1t$1$D$AMċ}D` 1D$1D$$}„}ԉ}]U1vSuAS(;S,s9C0C SS(U:MAL9 f$?҃vMЈQLA$o?%$b?%$P?A8 v0T$$.111g====u~k0D$T$ D$p0D$$p/tFE1ECS(;S,C0C SS(U:EԋMA=E؉AAA8A={S(;S,C0C SS(}=GH2G41$=d/ff=vD$)0D$$Q=MUy5B<0u0}D$T$G4D$0D$D$ $G8t{tv$ D$MA8={uK(;K,v$<ƒ9}G4\1D$0D$$UUD:=D$,D$D$ $)u5=t&SD$S0D$$=8D$D0D$$lt?E1ESunC(;C,sfS0C SC(M9uOS=UB8D$ 0D$D$ $A$;룃v}D$D$<$uE׋MA8$8;!D$50D$$t}G8D$0D$$GC0C SK(D$ D$0D$$]UB417t&'UWVS|}]u%SuS(;S,r^$[:<FtkPU D$$,6T$>E|$$D$:Eԃ|[^_]ËC0C SS(<FuCEEu S(;S,8$9OFEЉM̅EKu S(;S,$9FSu S(;S,$s9F}̀0EЃ<cKS(;S,C0C SS(F4SS(;S,C0C SS(F5EЃg1~s 5$肎Ef1҉]̉EE̍M}L$D$$S +}ɉD8v9u]/E $.D$ME SC(;C,S0C SC(1UȃEE $.D$EC0C SS(CC0C SS(C0OC SS(FEЉM̅؃ F F}̉F$07%EȋC!}̃='Et4 $UF,PT$D$$9;EV)lj؃='EK $|UF0PT$D$$^9;E)D$D$F,$-D$D$F0$ D$D$F,$$WF D$D$4$$E)UăF$FD$D$F,$zt$EUąVD$D$F,$:t@D$D$F,$tND$D$F,$tD$D$F,$t8u&ߍUT$D$F,Uĉ$Uąt }D$D$4$t8u&~u4$F&$h4kv$X4,vF(n$92E$p7ED$Q/D$$菼D$D8D$$轗$ D$\D81&V5T$0V4T$,VT$(VT$$UȉT$ V T$VT$VT$VD$ D$t8D$T$$UЅu!FS$7$ED$D$F,$D$D$F0$Et&G|$1$D$衸EF8kfEt&FD$/D$D$ $&Fd< v$T8oeFd<   $08AUTU9dN[N $M"MԍV7N@FT$D$F,$pFEF$7zE7$7bEUWVSÁE TM`UudEPd\eU1҉L`xht $#VKu C(;C,J$0ɈMGHSSC(;C,S0C SC(ωփ?Uݹ~P,CK(;K,C0C SK(Eލ@„DžX$ Xt$$T$Q0dt&{8Ѓ Ue3[^_]fS0C S C(ɈML$D$1$(9@뤐σDžXӥXXXU1D.C0C SK( ΃KuK(;K,rĉ@$.@Í<$z.<D$1$1ev O Fto|$D$1$x9t& T$$Lf1DžX\E܉D$\L$$2¸X> u6fvD$\xL$$\2)dvdxD$T$$/udXDt&TtEtTtwHDždA2u DžduE t$ |$@D$L t:@t$|$ D$;D$$踮@ Xt$$L$&P$ 9 ` ljAS]S(;S,QC0C SS(! D$$9}@D$t$$%@`؉ $&|$D$1$H9y`B$`D$GA$脷6`BD$_2D$LD$ $M<$$<D$1$1p$N$$?$K$0$X$$$'2xα\D$dt$$&KD$t$<$(t#C|S(;S,oC0C SS(\{[S(;S,OC0C SS(ddN<$ Ƌ`pHV\dF XVF <d~ ؉^"\? Yw\D$\T$ D$:L$D$$d]F1`Ɖ\d!$T$߳9>PZvD$ D$/D$$褪Ë D$2D$$wD$$.躯8=tA^ @t$ D$;D$$@B  Z $E!%$3!%\$!%d`\D$2D$$薩XD$2D$D$ $eF$`A0AtY1҉\׉d%C0C SS(d:9tCuS(;S,r̉$> ׋\ `A0}2tv2D$ D$2D$$表`Bte1`$T$n9t2>PZvD$ D$/D$$7Nj`D$ D$$FP$`BpBBLdtD1%C0C SS(d99tCuS(;S,r̉$5B`BxD$L2D$$]`AL1` $T$(93PZvD$ D$/D$$Ë{S(;S,C0C S<PS(+ $Hf1u-t&C0C SS(7CuS(;S,r͉$ءt$ D$+3D$$&{d$<`ƉAHF\dXV NF d1u+Et&C0C SS(D>9d~KuS(;S,r͉$uՉ1oFC<K(;K,0C0C SK(`N!``$:D$v1΋Cu_K(;K,sWC0C SK(D:9d~wʼn؉։ω<許<ɉF/-f@$@먋CS(;S,C0C SS(1`QB$Px@$r@%`CxS(;S,lC0C SS(GK<S(;S,0C0C SS(G SS(;S,C0C SS(G h_GCC(;C,S0C SC(W  1҉T$$G D$ G D$GD$D$GD$D$:D$D$ $ݢ1$%bDžtD$D$D$ $p3ŨXuItu&}vC0C SS(ltYKuS(;S,rЉ$ۍtC0C SS(*{uS(;S,rՉ$Suݡ$ D$`BPT$D$t:D$D$ $谡D$2D$$莡EsC(;C,S0C S<GƒC({JC(;C,>S0C S<PƒC(h=D$D$$D3D$ @D$0;D$$@$c$$$B z$&GD$ @D$3D$$2@D$ +D$ED$,$1^$BPD$1$ 23$&U1WVS<] }utNE1EUE|$D$D$v3D$ D$t$$Eou <[^_]ft<[^_]Ít&UWVSLE]u} EЋEEf$X ;U|~L1[^_]Í&;EsE1EUED$ED${3D$ |$D$؉t$$tL[^_]Ð&UWVS|$$UўU$D,[^_]fzu+$*$R4$$EU:?tωUoU|$$띍vԙt11ɉ\qt&UWVS,]=} uxԙt41҉ع ,[^_]À~u'4$$<$"Ɖ$X>?t4$薟4$EKE,[^_]1҉ع,[^_]fUWVS,]=} ux ԙt41҉عp,[^_]À~u'4$$<$rƉ$>?t4$64$EE,[^_]1҉عR,[^_]fUVS]=u uQԙt.[1^]t&xu$*$R4$8?t݃[^]Í[1^]t&UVS]=u uYԙt6[1^1]>xu&t;t$$4$A8?tԃ[^]Ðt&[1^1]? UE ]uD$E$Rt$脹$*؋u]]ÍU=EU u# ԙu U11^11U(]]uu }ؙtj4$D$ؙ$衙É$K$l$6VFD$\$$$D]u}]Ðt&t4$O$D$3됍&$P4$&<$D$ <$\vؙ0$@lUWVS]uE eU1ҋK EMvE1Et{ MyfB0B RJ(MtJ;JD J tdt`=U t8 9ω T9UK&t$$x(NSBu J(;J,>$B$ED$~}EZVSJrJ(;J,fB0B RJ(MtJ;JD J tt=U t6 9ω *9U!t&t$$PKR$計$DD$ED$}P;PD PUP;PD P Et- @UP;PLPECHvP(;P,jH0@ P<P( U 9ѣv}lMD$eD$DL$聍$Ë;5t4$cU$$؋Me3 Č[^_]Í&9Ervt$<$pU}U} P;PD  PMP;P$D$D$bUPi$pC1994$St&sF$躋$ED$E$(E$U:}f7D$$$t8<$g<$utÉ}M $mUt&$mD$D$ID$/U\$T$$#$j5]M $TuEvMD$bD $r$Vt&$t҉E&vT$UT$C$= UtM|$$L$v` E t|9щZ}HD$eDU$DT$M $\t&$Mf9Et&rEt$ |$D$$i9)…҉E$D&$ED$D$}_MEJ)t&$ED$D$M_MEJt&$tE'$>s~t&Cf C$$nECD$C$pEUvu$謆CD$C D$ ADD$2D$D$4$}D$Ct$$ID$ CD${ D$ D$2D$D$4$'t$$J$D$D$]MPCv$D$D$]MPv$D$D$]MP$v$@$DD$ED$v$EUD$T$C$MtU|$$T$\tn M E t59щm9Edt&Et$ |$D$$!9AE$$D$D$@\UP1v}4$D$CD$$EsòD$D$@E$胃$Džf1Vt&$uD$X$ED$AM $:蠆UWVS˃\EEKt&S(;S,C0C SS( ƒ 3V;VD ;VVDV}tMQ;Q+MDQKDži$9y\[^_]ËC0C SS(Uu#{uS(;S,rՉ$tUt݋MQ;QbMDQ뿍vuDV;VD ;VVu0ED$D$4$YVE t&V;VtD VV;VED$D$4$YVE $ED$D$UYMEQ&U1׹ T$D$s$NED$D$4$XVE#ED$D$4$XVED ;VV $ED$D$XMEQu UWVSLu}ԅFEĉ$tg$ $Ku@Eĉ\$<$D$IEى$U E$6uL1[^_]f$ w{Eĉ$RD$D$D$\$$舁L[^_]ÍEԉD$E$htEى$U E0$h 1D$D$D$$ 떉'UV1S0ED$E$$ht.EًU $E$1 4$0[^]Ë tNt$D$D$E$~$Ȁ$1뀍D$D$D$@~$$$,D$D$E$~$DD$蹺D$$$4$rtt$$I$ [y$yD$D$ݭ$j}\$t$$ft&yu$E4$$,D$D$E$}$DD$蹹D$$$>eD$ #FD$D$&E$$EsFU6&D$D$$ OC!<$zD$D$lG$v\$$xt&$UVU;SD;SSyDS1EEt&D$D$$hNCD$D$$HNCD$D$$(NCVht&D$D$$UMCUgfD$D$$UMCU'fD$D$$UMCUfD$D$$UMCUfD$D$$E]MSEfD$D$$E5MSED$D$$MSgD$D$$LS3v'U(u5]]}} u D$C$QƋE4$D$Sk|$4$GkD$D$$ttB#4$M]u}]À vC$Iuuf̍v봍t&'UX$]]u}C$It4$1]u}]Í&C$D?uCD$E $;EC D$4$xuN0u ~LftUtFUEڋM D$ED$E$S~Lu F8<4$71{7*S CỦ$^<D$$EOỦƋ@;FoKL;FF2KL;FFL;FFL;FFZL;FFTFEԅ1҉}Љ׋D8$x%V;VEyL;VV9DEVD$D$D8$iIU4$T$D$EIẺ$H9}{}Љ4$LD$4$$DD$$d$Er<$[ $EPỦ\$D$ ID$T$D$D$Eԉ$BvE$D$Eԉ$Ủ$4$mJ"D$fD$G$p$rvD$D$4$HVEt&D$D$4$xHVEdUD$D$4$RHFUD$D$4$/HFUnUD$D$4$ HFUUD$D$4$GFUUD$D$4$GFUBUD$D$4$GFUt<4$;sD$D$HH$!o\$$aq~4$sD$D$G$EnỦT$$&qD$D$$$nD$H$pft&U(E D$D$D$ D$ED$$ÍUWVSU{UD$$LCM̉L$lj$]ED$"D$ ID$ D$I$dD$ ID$ D$I$HdD$ JD$ZD$I$TIdvU(ED$D$D$ D$E D$D$E$ÐUS]t9wtNt;t;Lt$,ftt<uLt5w[]Ðt&D$bD$dԐ{`$`\$$MD$ih'UVSÃ0usu?[t(D$D$LN$?d\$$[^]D$D$M$dt$$뗍D$D$NJ$ct$$萚sYD$D$M$c$`4vD$D$=J$c$4&D$D$ N$Pc$ UWVS\} EeU1҅EE7W ;W($Eăj}D$D$J$bEE̍uЉD$t$<$_Mąu,U\$$ ^Ẽ1uIft>D$D$$D$ ^9}ut >$D$覘ʍt&D$JD$$|^E̅t11&>D$D$$D$ I^9}w؉\$$:4g\$$ gEe3\[^_]É\$$ fvW$;W,1$Eă}h},D$1D$aJ$`E-$xNbg&D$1D$J$`E&ẺD$EuЉt$$`f$=b,&1Ct& t&tfD>D$>D$JD$$D$ \9}u f^D>D$>$JD$譖ƍv\$$ e눍MQ<;QDQ@;QH_D$D$bJ$_Et&$|1ҺÍG D$$bEĉ\$$ D$$ vD$1D${J$_EOf$<贕&M$WwL$蕕gD$D$|J$^E$<`$1ËE$ uuvv~u܋v,tՋ9tWrύt&P: uvr> tPЋuD$ nOD$D$J$|Vt&v~bv,W뀐t&tSftq9t,[^_]ÃkMt&t&t׋t J qwMAD$ nOD$D$J$=BUD$ nOD$D$J$ KU'US]z[1]lUWVS,}G\W`E&kU1ۉUDD$K$D$NSuw\D$$D$%Su܋UG\Xw@uuT$ D$D$!K$REE9G`~G\d`u,[^_]D$OD$$JYv'UWVSE Uu4eE1ɉ0V DžD]Dž<t&kD@Z44HD$\$$-UH1NtG@֍v;4$D$ D$D$D$Y9Hwʋ@~0D<҃~4@N(N׉$,U(,81~, ЋD D$(F8D$$F@D$ F T$D$D$AD$ +KD$D$D$N8$'YND$$C蝶<FD$T$ PT$@$dV@< D9V CEe3u:[^_]Ít&0t&0HD$\$$O@VD$OD$$JVUWVS<u;}fE!&}$UɃED$ E|$D$D$F,$ _uEv}$UуED$ E|$D$D$F0$^u;Q<[^_]D$ OD$D$J$DKQ'UWVSLUu EUԍE܉EЍUEỦEȍ&UЋED$T$UȉD$ T$UB,$^4}~!1ۍv$ D$V9E܅D$D$XK$Q]tfD$$WwNSEUԉ|$D$$(fED$=bD$$MED$ |$$7D$n D$D$Ww$MEUԉ|$D$$eED$=bD$$MfD$D$tK$@P"L[^_]jPEifUWVSNjEĉ$iKUĉB$:Mĉ $E:?UċJ8#t1ҁƒ>MЉT$|$t$L$D$ D$K$GEċP MċA D$=b$GUEE0IE1u䐍t&D$t$$茗,H ,=<tuuUyE Et4D$D$$V5Ej<ME%AG<(:< 2<0*ȉʃUԺ'}< <L$1D$N$F@@EUЉ$MD$ T$D$8LL$M$L$M̉L$@Eԋ@f$ D$I}MD$$L$E&D$& $(@<$,4D$D$) ‰U$BU$T$D$?D$$?v  t&tE!fU1BfD$& $?<$4D$D$KSt&Ev<$3D$Vw$D$,?vD$& $?Uԉ$3D$D$5 $EAU$T$D$>D$$>,EE-D$& $><$3D$D$5 ct&7D$ uD$ $ D$D>v<$1D$D$D$& $ >MЉ $*3D$D$5 $@t$$D$=D$$=&UED$$fGUT$D$E$UE$/(fD$& $X=Uĉ$92D$D$K$@t$$D$=D$$="D$& $D$D$$KLD$ >UB0 Ex( UJ$  EEUB$+NjE$?/M‹EEE@UMEE$/UM|$D$ T$UL$D$$T$UT$ U8=u - 1$:D$@E\$:D$@$:D$w@UE: $ D$M@Et U$} 0E!t&x  (= $D$D$D$ =$:D$?EEE U$+ËE$,U\$D$BD$BD$ BD$| $D$6EfxgD$z\$6EXt%$-;D$ :\$D$$MD$z\$l6}%* }?t4 U<xD$ BD$ $D$6 tmUtf(t]D$z\$5]ȅt'1DЃD$$D$5;]rD$z\$5&D$=b$5 E$c Rt#BtE$UD$ED$UBt MU\$D$L$4UB@1ۉU$(D$Y$D$4UB8$'D$Y$D$4U$+Uu֍&FD$$D$b4uىuUD$+$A4UBBD$ B D$$D$4$:D$<$ D$o<.Z UT$$V9D$D$$lLD$ U9K0S(#C$8 uu EC$u&$E)EEEECM$E**UMD$qL$T$UL$D$T$UT$UT$ 211҉$ D$S;}~D$D$$Q 0,&ZED$$&4C$%$E`(EEEECM$E )UMD$$O$T$UL$D$T$UT$UT$ 111ɉ$ D$\:}D$\$$V$:D$:$:D$:EUa$ D$9&$:D$9UE$ D$9M0CE6$iD$W9nf$:D$39$:D$9UE}$ D$8EUED$T$$y$:D$8$:D$8C8=>=r$:D$t8vf$:D$S8$:D$>8UE$ D$8UEUD$D$$$rD$7$eD$7B0J4\MEET$U$]UUD$ \$D$bL$.UvD$ :BLT$D$$EkUED$T$$[@UD$ BD$R$D$5.mt&U$\11ɋU>L$ UMD$D$D$D$\$4$0UM5E }E%EtEU $U$D$D$D$ *3$:D$5D$E$5$iD$5EEF+ED$$耿uEUE$D$a5$ UE?U\$D$YL$,U{L1҉uމDMD$$D$T,FL9|؉uI$rD$4EELEĉD$E$5D$ :ËEĉ\$D$$OC$藇EUD$D$$hEUD$D$$I$:D$4$:D$3UB8=6=$:D$3fU$ D$ $D$+E$aT$$3$eD$i3EE$#D$A3D$D$$LD$ G0aU\$D$PL$g*UsED$ $D$D*E-z pE!bvSu7$K.4$z9D$ D$$LD$ /D$D$$LD$ ]/wEȉD$EЉ $UMD$,MEUExL 1ۉǐt&DMD$$D$4)GL9|$#D$1h/t&UWVS<] u]vtKSuRU$+UB$ M $E}#O8t1ҁƒ>{E ?tA }t$uL$T$ D$t$D$L<$?aE$$D$D$L$*t$<$D$aD$<$`U$D$D$5 $*t$<$D$`My1t y8t+}D$=b<$`<[^_]ÍD$L<$p`D$D$M$8*<$D$H`uFL<tAt}1]]D7MD$$D$ `GL9܋]QugOM 8u]}] t&D3LD$<$D$_ ~ڋ]D$<<$_D3LD$<$D$y_맍&UWVSL] E}D$$+CXD$PL$T$MJƅtw$EԍE$C$Up$Et$]ԉ\$UЉT$M̉<$D$ D$ML$D$T%4$xL[^_]É$E$M8C$U$t$M̉L$UЉ|$D$$MT$ ^4$L[^_]Í&E$/&'UX]]}}u|$$&<$/$<$EC$D$EUԋMЉt$|$ T$L$D$$%MC^4$[]u}]Í&'UWVSL$EEEE9Ƹz4$1A`E؉Eĉ}_t&E$%=(#EĉD$ 8D$EԉD$E$E$MxE4$@ED$4$7=,u4$79ÉsD$D$$#<$(tt&$-D$+u桀$ D$+fPv$t&$;MD$'(t ,tO&E$Uw4$7L[^_]Ðt&tۍv$蠉$HOD$'뾍E뮍$p$D$p'뎍&'UWVSÃLED$D$YM$$%EEE9Eut$ \$D$$!$ӈ$aMD$&E$L[^_]ËE$$6|$D$k$ÉD$ !$+&<$!&\tt&$-D$)u桀$ D$)8D$ D$D$E$}D$=b$ 觬 14[]fK6;E_D$NV$FE;tD$5$E;tD$ $E;$D$0$x &ED$ED$ ED$M$D$@U]ÐUVS}x4$D$ 4$#\$t$$'#uf$&tt$D$$"[^]D$ OD$D$O$O[&U8ɉ]Éut#lD$D$$Slt8$DždD$t$$]u]Ít&U庀fR>* 1ɺ 1ɺɸ vUVS]Y{c"QD$D$=b$9t$t$$D${D$"D$i$Z@w4`4$1t$D$$-D$D$O$11=][^]&$UVS1t& QvQЀ vQv(t 1[^]ÍutY1ɍv'\H9)0ӈTHt.9~\Hp9~׀F7ӈTHuҸ[^]ÍvW볍t&'UE Ðt&UÍ&'UVS]C1$tCC$tC C$tCC $tCC$tCC$vtCCqCpCoC2C1C0D $KtD u[^]Ít&USÃ1u 1[]ÐJvJЀ vav u$(utCARDPf@SN@: HKJKJK J KJKJKJKJ@'z'USEQt+D$D$$][]Vs[]Ív'USӃ1҅t!$ \$$OD$E[]Ð&USt!C t$ƿ$r[]ËC$t&'UWVSLU < < U1ɉf7< tc< u< t< t]ԃ#tP _RR &t&L1[^_]Í]< t< u]둿 R`RuD$ D$]ԉ$tB  ]ft  u t t]ԃcBUEԁšY]Cq&]1R}(RG<1t 1<2ҋEPL1[^_]Ðt& tC ^c#D$D$Eԉ$lUf1R  }t f u t t]ԃcsUEԃ[]C29 fJxR ar $Rt$EFσ6U)$@lMԉ $]UB$lMԉ $]CU1UB$kMԉ $]Cf]t&t&]Ԁ t *]]Ԁ t ]fU11t&< t< UB$.jMԉ $]CD$ D$Eԉ$Mt:  txˍvt ta u t t]ԃD$ D$Eԉ$GU]t&]Ԁ t u]뒉4$Vi9&F҃7zE$P fJ1MM9Tf0|C9Y0ҍ479ƒ~ 1(fM4C9~F7|C79~F 7랍vW둍Wi@$D$D$(Q$D$$SD$r^ufa UE tUD$ET$$1É'UWVSu tf< < 1Ґt< < u< t< tt&t&uS1[^_]Ðt&Suބt9< t< lt< < uf< < 4$t&$@`f0x@@t$$$,|$Ɖ$11fS<$D$ D$D$D$9swȋ$GT$2_$U1fD$$G^<$_D$D$ T$|$$"4$ $1TAD$$G^$$ TD$4t&UWVS,5eE1E ]cQN )kd)Ӆɉ`TT$$D$D$iTD$ D$D$r\$ED$D$D$D$D$ D$F $yT!É8Ue3,[^_]ÍvuJf\$$D$ 0D$2D$j\$D$D$Н|$ D$4$VdXVfUWVS<eE1EuUۉ1 C }TU D$D$TD$ T$D$D$<$Et$D$`D$D$D$ D$|$C $TÉUe3<[^_]ÍuHm뮐E D$0D$ D$D$D$<$D$D$НDž`$|$D$1}D$ D$S`fUWVS,eE1E u}ۉDS t$D$QD$ D$D$4$3UEC D$T$D$D$D$ D$t$$ETÉUe3,[^_]Ðt&t$D$TD$ D$D$4$rE$E|$D$D$D$НD$ t$D$S\ct&CPft&'UH]eE1uu}} K 4$ =v"Ue3]u}]ÍDžSCD DžGETADžTTR ƅt$$|$D$D$T$D$D$ D$C $|TPt&7t&Džt$D$$SD fUH]uu}1?C tvt$D$D$D$D$ D$D$T$T8Džt]u}]Ívt$$R܍ED$EEu܉D$$8u}<$|$D$D$D$R}D$ E؉$lE$LED$D$$S8Ot&5&U8]uueE1}ۉ{ 4$-=v'Ue3]u}]ÍvDžSCD DžCHECDžKPINfDž t$$MD$D$D$D$D$ D$|$C $T`ÉwHfk2v$D$ D$Нt$ShvUWVSLeE1E]} ҋus@ z$ =v(Ue3L[^_]Í\$DžSCD DžSETADžTTR ƅ$5 XtjU9Ӊr@$D$D$ GD$D$t,;M<+t<v<%t< twuD$D$D$D$D$ D$D$B $TÉ&+Wt&{uD$ \$t$|$D$Н$PHt&UWVS\E e M1ɋUu}K tمt;ЉS ҋQЋUe3}\[^_]ËU|$D$T$L$D$ D$Нt$$STt낐t&3OfUD2=wDžSCD DžSETDDžATA ƅtj1҉1Ӊ΍v4$D$ D$D$D$69]wˋL$D$D$D$D$D$ D$C $U e$D$Z$t$D$ UD$ D$D$L$ ED$D$D$D$D$0D$C $UctD $D$$wF4$|$$豔q'UWVSlEe M1ɋUu}C tمt;Љ~[ uЋUe3l[^_]ËU|$ D$D$E T$L$D$ НD$t$$SLtxvGz&UD2=wDžSCD DžSETDDžATA ƅtj1҉1Ӊ΍v4$D$ D$D$D$9]wˋL$D$D$D$D$D$ D$C $DUU$D$,U} tu$t$D$D$;UD$ D$D$hL$ ED$D$D$D$D$0D$C $KUtD $D$蛑$#Cm4$x|$$]MyUWVS<MM Mo7_x r t'} c!E̍Mډ $D$MЉE9E9re)ڃvYYw>ɉ˃MtNXxrv[trxpwt&1<[^_]Ívރt؉΃] u늋M<[^_]ËUM뱍&U(uu}} ]M]D$$t )ƍ<>;;!Ћ]u}]ÍvUMEU E MMN&'UWVSu UE$}U }7}7uɉt8ҍw0y{փ1҅t2t;EU t)UE U8u݋u [^_]Ív} }uEu U u1} [^_]Ít&0҉ƍt&tǃ xuɉ끐{EwfUWVSE} uEEu61uL[^_]Ít&<(tI1<)tcU\Xt<:tXpЉ wmu؃-[^_]ÍvE1[^_]ÍtʋE.ύt&U9wE)ډEىE1CUufD$ D$D$u$zUtԉ$`I$`D$`Í&'UWVSÃv|$$T$DB<^wPJ^vD$<4$ uED$4$tWD$D$ a$$]4$u=`D$D$`$x$,̓[^_]D$D$`$H$띍v'Uu $P MÐ&UWVSӃ,EMD$i$-$[$迯uc۸t؉$>\$t$ D$$4$E8,[^_]Ðt&4$t$lD$D$ݭ$.\$UT$$,[^_]É4$1뀍t&$D$D$U$\$UT$$i<$;%[$D$D$Ha$s\$$4$jUWVSLD$ED$UeE1$$UD$PE$1}A]8<:< tT< ftN$&t\7tB< tv< u< u< uꍶ< t< t$ʴuEĉ$::D$D$la$?$vUe3L[^_]Í-Eĉ$9;u}Ut}Ut}Ut"D$ D$|$$Cu vq$D$UD$fUS4e M1ɍJEPRIVEATE-EDO-XE0UD$<$^R@ t|t& tsM=D$ED$ D$E$]uOE$8Ue34[]Ðt& y j$pC$PVD$p뗍뜐D$D$#V$8$5VD$NtȉE$>E$ D$D$a$D$$E$7 >D$ nD$D$U$VUWVS<G8>>X@< t[v< tTED$ED$$nVtL$$VD$I¸t1땍vxou1D$ nD$D$U$Vv'U(]É}׉u@$1u C$u_]u}]ËCD$D$t$zUD$ t$_?$`bD$_먍&$8?$VD$8 UWVS,EU]tq}D$D$c$U$T$$VljD$IK:>u><$1|34$t3,[^_]fD$D$b$pfD$ D$4$<$&34$39] f t&wvvnD$D$dc$\$$ LD$D$c$$r,[^_]D$D$ڋ !%tꩀtK)ډ\$D$ T$$Ru*Ue3ub]u}]Í&뭉$ <D$D$pd$tt|$t$T$ $a'U?(]1}߉u\$$R}DCt!@W u$/ D$D$MW$UD$D$d$7\$$7]u}]É$;D$D$d$\$$뽍t&\$$`Rpt4$:D$D$d밉\$$GR>uΉ\$$R(u\$$RRu\$$R+UWVS<eE1\fEDž1Wtt&|rmu1XtfJu1Yt8uL$=b` D$D$@e$D$WD$W$, $=b ؉q|utJEtD1 fw6T̉t‰&tډ$3u2f$#D$D$m$赸Ee3 <[^_]Ívuu$=b< D$D$e$d$$=b D$D$}W$4$WD$A]$MvD$D$d$$aWD$BD$Ɖ$_34$,1W"&'UE uE PT1fUWVS,U E҉E~$1ȌČ m;t?C 5ȌtČD$E<$D$suˉ},[^_]t&,1[^_]Í5ȌUWVSÃҍru4i&FD$ FD$J$D$S uD$<$FD$ FD$J$D$`D$W$N$D$=b8[^_]USÃD$W$Sr{o!1D$W${p!1D$W${q!1$=b=[]Í&UWVS<}eE1Gt,t'D$ nD$D$U$e7v@:1u4EuL$ f$=b1$ĴUe3j<[^_]Ív$B<t UyE 6u 1ҋM D$D$fE ‰$$yAD$D$UX$$fXD$>M/u4$~(1&<tD$ D$4$(4$F(Pw8t-MtvEup;Ttd$fCvD$D$X$$&$Pf$=b1‰Ɖ1${1҅]B8=5=$D$SD$$Mt$Ӌ1IvDžDžDžD$D$f$$D$D$ X$$r&D$D$:X$$<&D$D$#X$R$Rt$$qt$詊GpF$'F$艗9s9T`։ǐ$9w⋵F$@$0'D$P$D$*F1F8D`FLW1ƅD&9H0ʈTM<FLw_tUWtM9~p빍F7뱃WD$D$f$$1$/D$D$Lg$t$$'D$D$$gD$D$fqv'UWV1S<EU DžeE1؉t"Ue31<[^_]Ðt&D$D$lg$$]D$D$ X$$9D$D$#X$a$D$D$:X$=$3&<$#D$D$X$$D$D$UX$$XD$8i)<t<$D$ D$V<$ƍ~u"lt1$YoquڋMtrEftjFƍvtD‰%t7$2t뉍t&<$1v!it$D$ $D$6&fUWVSÃt/1t&7D$D$$D$ u؉\$$:[^_]Ð&UVSÃT$D$Ww$@t4>t/ېt&tf4$D$ t$$D$,t&D$D$X$$D$$D$=b[^]Ð4$TD$4$D$ʍv'UVSeE14$LD$D$X$.\$$n$`Mt[UEЅ^$D$_$*$XD$hv] t&$=bD$h8$=b,D$D$UX$T$#YD$05%$u<1tM<2v<3<4=,unD$D$X$$D$5,uV$D$=b[^_]Ít&D$kYD$Ww$끍\$$:T5,t\$ D$D$$Z[^_]Í4$D$YƉ$Bt# v ttD$<$v,u74$SD$ t$$D$G4$_f4$$D$ :t$$D$ύ\$$:농<$D$ :|$$D$5v4$D$4$D$$h<$D$<$D$&'UWVSLEe5u1] D$$8Mɉtt$Vtp,4$J"D$D$g$0\$$04$Ee3L[^_]Í&, D$D$Y4$t-@W u$G |:Yu{H: YuoH: YucH: YuW=, $Y}ev D$ D$YD$$謹8vYux5, $Ti$ Z $蜠4$~D$D$$YD$ Vt&:YP:YP:YP:Y,6 $xibGt&t,$誽9E$i,x0XH x 0p P  t$ L$\$T$D$i4$H9z Ƀ0X9L ۃ0P9 ҃0@<9| 0 jZ t J YZtSZw Zt&\$D$w[$D$[D$4$.[L/ D$D$[$\D$D$[$^[[t\ t(\t=\tR\jU   UD$D$|\$`D$D$\$bEȅ ED$\D$E4$D$ ED$,ED$\4$D$ED$ ED$ED$\4$D$D$W4$ZW!‰Wt E# D$W$nX!‹Xt E D$W$TUY!‹YYt Eo ZD$&]$ Wu XnuYt"]t&1<6uD$;]4$vY u , $i讹,D$ D$$Zt$ Y&T$$P/&D$D$$5ZD$ 边=,D$DZD$ D$ 4$UP9' ҍJP9R ҍZP9( ҃0@<9 0  jZt YZt SZwZD$ T$D$ZD$$覲D$ZD$D$ 4${Jt$ D$D$$Z~t $t&WquD$ D$$Yt$ 3t&Fۃ7vFɃ7xD$D$\$踰S&C`:CLfCP`aCT@^CdUChPSČ[^_]Ðt&$0$xD$D$jUfD$ E$xD$D$M@M($ oMt&T$D$$uMوM]$o貌t&$v܌ED$E$uD$蒈Vt&s0F0uD$$/w蕌F0uD$$EwuF0 uT$$jwKF0uD$$w+F0uD$$w F0 uD$$wF0@uD$$wˋF0@twxwT$$wEF1$wD$葋F6$xD$}F8$xD$iF,uD$$,xIF,uD$$Bx)F($XxD$F<uD$$pxF<uD$$xՊ{C0H0&$v褊ED$E$uD$Z]$\o1E|F4$ZwD$F0D$D$o$ۇD$w$׉6D$D$o$誇D$w$覉U8]ӉuM}U$D$ntP}vJE@uwD$D$x$/$s4$ ]u}]ÐD$D$o$$4$뿐t&4$D$D$p$譆|$$@D$D$\p$耆|$$ …ҸK0BD$D$x$@$UWV1S\EeE1v XvXЀ vXv(t$Ue3\[^_]Í&u1]$t&LB9+0 t4 B9~LBp9~ՀF7 ũEȺn$EMD$D$SuoEĉD$ ED$D$Ẻ$^t}tG ut&t ;t&tEЃEĉ$MMENEЋUBEBBŰEUЈPUUPE̋UEBEBBMiUԉEB EB Uԉ|$t$ $UU؋M<:+GM\$<$L$迀UĉT$ EԉD$U$T$ ~Eԉ$U}Eȉ%uEȁD$E\$D$D$ UȋB$ R}wČ[^_]ÐEUEEUÜEEUD$D$ t$D$UȋB$Qt$E2D$D$`q#$E D$D$8q$}\$$UČ[^_]ÍvUW1VSlEU EeU1҅ۉuo& X$D$uڅ:40v1vB0HHPD@@t$L$ T$D$D$yD$ D$D$<$Z|$\$$ru1Ue3l[^_]ÍD$$^tV{D$D$\$D$ D$$Jxƅt^1f1Ӊ<$j}D$ 0D$T$D$$9v~<$}D$D$|$\$$D$ w$t&B01H0@tက҃T$,P0T$(P1T$$P0T$ P0T$P0T$@0D$qD$ dD$D$D$d4$#4$+|D$D$t$\$D$ $v1D$D$$kt&uD$D$$jC]D$ D$2D$D$$$]{4$M{D$D$|$\$t$D$ D$R}$u$51ED$EOPENEPGP.fE3D$D$D$ \$$iu1i4$zD$D$D$ $t$\$u$1 Zf1} BZ J t$D$ 0D$2D$<$}$\$D$ D$2D$n}$y<$yT$D$D$\$|$D$ $D$th;[1f1ډ$u,4$&;uD$ D$2D$4$D$}|4$xD$D$t$\$D$ $Gsaz'UVS]u D$RR$t$D$Rt$$D$Rt$$D$(Rt$$D$1Rt$$D$&D$yt$$|롍v'Uh]ÉuΉ}H,1҅t]Ћu}]ÍvUEEEEEUuu"ẺD$D$ C$NED$E4$D$׉‹EUĉ$pUEubu4$+vD$D$q$VtD$D$$JvE$ t&$D$D$q$s\$$>vUD$ t$D$C$M‹EUĉ$UąC,|ED$4$D$׉‹EUĉ$TUEBẺD$D$ D$uD$C$XLD$D$4$E׋Uf$U D$D$y$rt$D$$tUUX]ӉuΉ}y v]u}]ÍEЋUЍE$MD$lEt}vE8tUԾ$렐t&VUPEÜPM UEUD$D$ET$D$ G$8EƋEԉ$tU̍CD$$rT$sW0t*t]Ԑt&$nۉu]ԋW0ډ#G G(G,Eԉ$-E$t1-]uuDžHߍUT$EUD$ ET$UD$$GE9f}uED$UET$ UD$ET$$Et } E]ED$UET$ UD$ET$$躀yE99~v-Hfdk F0@@`E}U9`!ǃ=tEt$$sD$itdB0@0 19`D$D$s$f`t$1$hD$1-D$cz$Pf$ThD$ D$$XzbUT$EUD$ ET$UD$$X}bEDžHAUE]D0<$D$T$_DDADPD$ 8D$D$@v$z\v'UWVSÃlEU}M}EEEEED$D$t$=]$^E2$EMD$D$t$]U D$ D$T$D$E1D$Eĉ$pbuO&EEEEED$D$%{$\EƋu"UԉT$D$ C$t6 t$|$E$UUĉ$&74$]SD$ D$q$[D$UT$$]$豴l[^_]ÐC0@< uqD$ D$WD$C$v5t$xD$D$xt$^[|$D${$]C0`x$dv?D$ D$O D$@v${:D$ D$L D$@v${:D$ D$N D$@v${:D$ D$P D$@v${v:D$ D$Q D$@v${R:D$ D$M D$@v${.:U=l~H=t&= t& = t&}^=~W9f]Ít&=it~R=jtލ=jt=kt=jv멐-]Í&=gvt=hvt=i t&j=hujv]Í&1=Cv=t&t=r=u= 8=t>%1=af=j%g=ifuōv=bv=et&uv=mv=nt&qfvUEu]Ít&]v'UVSP]U Eutt}t-P[^]Íw=߃|ڍt&uMEEL$(ML$$D$ D$D$D$T$D$ D$D$E$27=bt;=t4U$E$E6vEEP1[^]Í'UhEE ]]uu}}]]fɁMԉt$(\$$}sEM|$D$D$L$ ED$ GD$T$D$M $61t4$]u}]-]u}]Í&'U}} M]]uu}}EU uu}}] ]M]&U}} M]]uu}}EU uu}}] ]M1]Zv'UXE]MuU}]EE} u |$t$(\$$T$ L$D$D$D$D$ D$E$v41t/$P]u}]A-]u}]Íe&'UXE]MuU}]EE} u |$t$(\$$T$ L$D$D$D$D$ *D$E$f31t/$@]u}]1-]u}]Íe&'UXuu]E }U}]HM}v f~L$ ։T$<$t$(\$$D$D$L$D$ D$D$b21=t4$=]u}].-]Ћu}]Ít&U1WVS|]}u EMEUЈUϋU1M΍UEET$(UT$$D$ D$D$EL$D$ D$D$D$U$MA1Mȉ0ҁl&M=k=bEtN=tGU$EM$܊UEv-|[^_]ÍvE$D$׊UUT$U$T$&3EE$bEƁw)9!Ӏ}t }u1t&|[^_]ËEЅuxf1܍t&EME뚐U%T$(UT$$D$ D$D$EL$D$ D$D$D$U$/E$草M$耉E&UWVS\}] 4Ɖt$E<$D$1uE)$E~ED$(ED$$t$ D$D$D$D$D$ D$D$E$.=u7E9TuMv\1[^_]Í\-[^_]ÍvU$EZEb\[^_]Ív'UxEM uu]UE؋EMM] }}$EĉM ۍvM=MFEԉ$U謉E܋UܸҋUME܈E܉t$T$$+0|$(\$$MĉL$ E܉D$MD$D$D$ *L$D$ED$M؉ $8-ƋE܉$1t.$]u}]-]u}]ÍME|$(\$$Mĉt$T$D$L$ D$D$ *D$ED$M؉ $,S&'U8EuU }u]M}xv]-u}]Ít&= \$4$L$D$T$D$ "D$D$"+]u}]U(UET$UD$ D$T$ĉT$D$E D$E$*vU(UET$UD$ D$T$ĉT$D$E D$E$y*CvUS$EM] UtItE\$T$D$D$D$ ,D$D$ $!*$[]&$-[]Ðt&UWVSEe M1ɋu Ut,Ue3Ĝ[^_]ÅuЁ}wӋ]tp}1Mt&fT9uED$EL$D$ D$D$ D$D$$0)\0M볍w.vUS4E U]҈MEt4[]fu1=?t }҃ET$D$D$D$ D$ D$D$E$(M4[]Í&U(EU T$U D$T$D$D$ D$D$E$('UXU]Mu]}u ҋEu]-u}]Ít&tt 8}uGL$T$t$D$D$ ,D$D$$']u}]Rfx |$(x|$$@D$ EL$T$t$D$D$ D$,D$$&룍U(ED$D$ ED$E D$E$UhE]]uM}uEE ۋ}U EEtɍt&Eԉ$UЉMVM̉E؋UظҋU}E؉|$L$؉$U)UЅt E؉D$EԉD$ED$ $D$D$D$1D$E$&ËE؉$躀u؋}]]&-]u}]Í\$t$E؉$!)M̋U/fJ L$(JL$$RD$T$ E؉D$EԉD$ED$$D$D$1D$ E$$@t&U(ED$D$ED$ED$ ED$E D$E$fUXE]] uu}}EEtuM|$t$\$D$D$ D$D$M $$]u}]]t&H L$(HL$$@T$|$t$D$ \$D$ D$ D$E$#렍&'U(ED$D$ ED$E D$E$U(EP T$PT$PT$ D$E D$E$z EUH]]uE}U Mۋ}utsto\$t$|$L$ T$D$$G u" vGDL =u*]u}]]-u}]Í$E}EfUVS@uUE ]t$$\$ D$D$D$D$D$ D$D$$"=t$E}E@[^]t&@-[^]ÐUUjjefm3nt~tqѸ0Ɂat_ÃtRtEt2"t؃tҸ4t `t&]Íit~Yit܁j7tρiN뼍t&jTtE|jy#두e܂tgrb\t&kBf 2/F $]Á]ÁD<N]US]$1ǃ[]Ðt&UE 1]U=v0= t'v^=tn=iu!]Ðt&=v=t ]Ít&=s11҅t= u뼐t&=  t= u렐] UUwE 1]Í&'UUw"t 1t t&É'US]wu[]Í&$utӉ][]⍶UVSu,1u뀃u[^]Ív4$Ct4$ōUS]wu[]Í&$utӉ][]⍶U$t$Uw3t$,1t$t$]␍t&$t$]Ð&US]wQtBǀHt $Ѕu 1ǃH[]Í[]Ðt&U(]]utUT$$ЅukUt^txuRt>tdž$udž t&]u]Ð1UH]Éuu }}wDt7t@UMԉT$$ЋMԅt*ǃHv]u}]ÍDU9tV|t6Dǀt1t|1뙍t&ǀx뾍t&u랍t&Uuu]wTtE1ۅt4$ЉD$$؋u]]Íu؋]]Í&UMU EM MM1pU(UE ]u}Ew;t,$E]tU]u}]␸]u}]ÍU(]uwWtH t9]\$] \$]L$T$$\$ ֋uÉ؋]]Ít&؋u]]Í&Uuu]4t6$4$s1džuǃ]]Ð&U1҃(uǂǂǂǂ ǂǂǂǂ Tǁǁ ǁǂǂǁPÍv+$$EEÍv'US]18u[]D$$0t[t&D$T$$z []Í&Ⱥiwʋ&ǃ81[]D$ YD$'D$z$fU]Éut,(t$ЉLt Ƌxu ]u]f\$$ӄxTt$$uD$]u]ÍUE$4D$Ðt&UULt ɸuD$T$$eÍv'U]]E e M1ɋUuu}} G$crҋT$|$ $ E -=DžDžD$D$ $Nj$oe|T rEt%=a$.qT$$T$ $n L1tT$$BD$1Ue3]u}]ÍD$ |$T$$DžDžt&E $pM  $m><$\$$XD$$m &BjDžtW$o‰r=~$D$L$DžYƅƅ ƅ1tfT$D$$|T %=attb 1҅+9s[=sD$$k+ D$\$ $ 7X$4\$$XD$@$kUD$|$$|rt%=aX$CD$D$3t&|$$D$nD$|$$T4t%=a.\$$CT$]f $jU|$$ \$Nt0+D$$i $i1fDž$Nj$̉\$D$ $Mi$D$̉\$D$P$ie$hMD$ @D$] D$z$.DžfUWVSu$EUM ](eE1oE=6DžDž}t 1;EM}PX]DžxE E$ciU3 MiE $"iÉ_N|NDžxstVMNE FFEx=EFUVMtL$D$$Mσ}DžtE>ED>Dž; >)t&D$L$$4 D$$L$TL ʋ*kt-lh4$Gehl7btsul$fllL$\$$` ll4$dltGt>u6D$$BD$ l t&ЋUe3ļ[^_]Ígΐ}t&=t&볍~ }DžDžUME T$UL$\$D$T$ L$t$$dp LvulDž&0ɁlJT>Dž&}s)EVMNE FV||$L$$W xPESf}@[dDžt%Dž6DžDžDžDž&$$T$D$<  $a4$an$$L$D$ 4$ta$fa!t&VMNE F}Dž}M >Džt&!t&]렸 Dž4$``%=aDžtcl$dblƋ0=4$lD$\$l׉dDžƅƅƅ{1tftT$D$$3|T %=attb1҅+9sX=slD$ $^l+ D$l\$$l#[ƍDžDžT$lhD$$|lht%=atlh\$D$$DhlD$E|$T$L$D$ 0$HT'US$EU] T$0$+7uUt҉$[]Ðt&$[]ÍUE0$`1fUS]0$uU1ǃ[]ÍvUWVSVt 8D$$V D$ $D$"$@D$6$4D$G$8D$\$,D$i$DD$x$L~D$$0iD$$<TD$$(?D$$T*D$̆$P5@uУH< 4҉U8҉U,҉UD LɉMS 0N5<uF5(=T}b=P>4D$ D$D$$@n4ut$ D$D$$8Ej?T$D$$4$4ULJ$1OČ[^_]Ív}tD$ D$M $Ë5D$$h>D$$D$4$D$4$ ɣ-?D$f$t džxǀǀPǀ ǀ`ǀǀ`Č[^_]t/ƋED$C0$G^GdžEdUV1D<:uut&E$OEt$ ED$D$4$8SM]ЅuIvV\$$܆($UH9Ѝ4u$ft\;u{uƍE$9$ZN@Uu$t$EЉ$"Lǀ8ǀxǀHǀ`ǀ ǀpǀǀ `ǀ ǀČ[^_]Ð$ȍ<t<t<tT$\$$rLJCxD$ CTD$!D$C0$:CxǀPǀ0ǀPǀ бǀǀǀ@ǀ ǀPIEMЉM)ǀHYD$T$$HQLJ\$$x-5, 8=LDu5<M 0}ĉuȋ=T5(}̋=P}ԅD$01}D$,1}D$(1D$$1}D$ 1D$1}D$1D$1}D$1}D$ 1}D$1}$D$:$5<uȋ=T5(}̋=P}'5 vz ~?  VzJR N ׅ >mE 1VzJR N ׅL V {,zJR N  ׅ t&yV$zJR N$ ׅ7# t&t&V(zJR N( ׅW#E' rt&Z@t&g* *t&t&t  C*Ee 1V0Z ~1f V2>~34f ~4t  K86vk=1 ҃66vH6t&69v/t>$D$69wхM U܅u C8 E f{ 1<[^_]Í&E$f-Exx$=bN ~ =AQIL  ȉD$$N~=AQI  ȉD$$ؘNF$D$-N~=AQI  ȉD$$(N~=AQIJ  ȉD$$TF$D$uv$at&{,0Cf=f=Q+f=Qf7f=f{t&58C,01<[^_]ÐF3҉T$$͑D$!F4~4$D$$|f$d@$\5yv$Ԛ0f$f$|f$f$=bP$(f$f$f$|n$=bcX$L0f$4fE$HEt&1҅K8 $=bF5$D$f C8C8EN,V,MJzREہ  щL$$ $HV0$=Y$p~1{}$ #$M&1҅^K8t&CD$ CD$C $D$M1M t&|$$T|$$|$$ |$$|$$Йg$\tm$D$T=F$D$2 F~D$F$ܗD$?~$=b6F$4D$FR<t<Wt<\t"T$D$$\offC8C8Et&tn$Xf$f$Xyf$kf$=bC&tE<$Et&$d&$Ǒl&F0$D$L&҉T$$-0$0$ߑf$$$f$&$ |f=<[^_]Ðt&t$(@f{,t&f=Q&f{!t&ff{t&ff{t&f$h$Ğ$4^1~41}1f~11,19vUWVS ED$D$D$CD$D$!D$D$ $)xƅxrƅ}~ƅEEƅyƅzƅ{ƅ|D$D$ D$CD$$ tNxD$D$ dT$CD$$? }=uy@u`xt}t~91s$5Ue3Ĝ[^_]Íx=듍vE$\D$ ED$D$[t&t$3$LD$of uV Yt&|$$vt$$v$t&W $$$D$D&l $j$D$ u5vtD$$$fD$$LVfUW1VSà Ytt=$ 2G)9u(s_=E(t$$D$ƺW(9t}=$d蕺 t$D$ $-3 y=@$; V=$( 3]Džut&'UWVSE ]Ue M1ɉp|D$l$A|Džt}Eb EC$EƃC$EEEEEEEDžx $Wx$dD$D$ t$D$Ft`E@t|}uC =3Dt2=jt+ Me3 Ĭ[^_]ÍvsD$D$$pDžtc8pt5xu 9pEt$D$$׷l1El EC$EƃC$EEEEEEEDžx $Zb<EaEC$EtC$EEEEEEEAEEEEEEEDžx$txd$D$D$ D$D$O'zC4C8C(C){*0{*EE҃UK,ɉ1йUEEoEC$Et=C$EEEEEEEDžx~kMc uu%pRpt  It$ T$D$$8׵x$atx $dD$D$ D$D$x U¨ Džpcu DžpuÉtÀÉ߁!tRt  IpL$ |$D$T$$H趴E%=W}ME$D$v=$\&x$dD$D$ t$D$w]x^}TEaEC$EtC$EEEkt&xE<<C4t& uZE@$Tu ҍvu.2DžpuĴ$dfUWVS<MUe=}1]E ɉ S8Dž Dž0 twf{ ktG t:U }Ue3\ <[^_]f{u}vxuDž Dž0 {*4у Dž,Dž1!щ0DžDž 0(t&4҉$}O 0<C(GS49U~4U$W4GT$$L$441ɍ2u4 4 kFS$V׃S$PNшVFFF F NV0,҉Lu0=,0L Dž4cu Dž4u%Rt  I4T$D$$8L$ ׯL$aC D$D$L$D$ |$L+0 =,=3 Džcu Džu€‰4ׁ!4Rt  I|$T$L$4$HL$ r ts(K)9(C)ȂB22AB1ҸDž,DžDž$41oFS$V׃S$VVFFF FV&ʉ΁ƀ5t. M@L$D$$D= ? =1Dž,Dž4 )Uщ$Gut&K)t訝nEE}Љxdx EEEE!UċM$@y6E}y  W11҉Mt&;WtCtC0= t{uҋEāuËEĉp$趥pUč}ЉE D$D$ D$D$D$<$"E2Ue Ut}<$,X4$!D$šEtE$D$ҢU$t$$転$ӟf ]E14$U$}ċ?}%x҉x0sE1E*}50>D$$(Et$(($͠Q4\$D$ D$ED$D$4$葢MEtE$豞X4$覞D$JMtE$D$WU$蜜t$$@$Xf E]4$s}Eĉ$Nt&MEA9Et&}ăEE!9E;}trf|Fmfvї$'$D$Ýp||t$<$|Mt=Ut6C$ UsSK$T$L$CUEt C}}t1҉UMt}UtUEtEċ}}tZU2E}1Ue3;ļ[^_]Í&Ut$$ T$虜54$蠚4$蓚l8t&5K$衖\$$LD$9}fmUt$$ T$}<$ 4$E$d1у $KEЉD$4$D$4$R||t$$N}t}U:}E01td}ċt:T}G}1U:8}t Uĉ$}<$4$ }t Uĉ$ћ}<$֘4$ƘffD$ HD$6D$v$˗6fUVSP]=s2EEEvESD$E1ɉD$E܉D$ED$ED$ ED$ED$E$D$ t<  u P[^]Ít&C$tD$řP[^]Ít&EtEMUCECE܉CE؉C :tf E$|t$莞Ct$HCP[^]Ít&P[^]fED$E$tu( 녋E$$ܘdt$ $˜J'UH taM1ҸD$ D$D$D$D$D$ D$D$$k#EÐ还  UWVS| }u EEEEE1ۅtD$:4$$E܉D$ ED$ED$EĉD$EȉD$ẺD$ EЉD$EԉD$E$M؉t:a Ǘ Yt&D$H$蠒:U؉PUU@fH fHfPỦPUȉPUĉPUP ^];MЋUԋF -$ ot&\$ $SEԉ$\E؉$QEt$bE܃t$"$(|[^_]Ít& t$ $tݕ눍vs$ĕ躕bt&D$ D$4$|-$ ofE1ۉ$oHE؉\$$tD$9t&U܃H8PUf@ ffP@*@, @0H8t$D$ nD$D$v$ 51҅uVH8ẺD$E$蚐& (D$$kE$@WEH8D$ ]D$,D$v$hUEu,t&RHttHQXuQTu鍶1]Ít&]ÍUE]Uu] ttI1]u]Ít&ștՉ$Rōvt2t$h9șPt$SgpwS$#^PCcZ QH >vș뚐t&Ct&v%$Bgt&C)t&vCf t&'UVS]t3C$N$ u[^]Í&'UWVSÃ,=КMu Tt&tI\$$菒u_t01CD$4$膼UۉPu,[^_]1,[^_]Ít&UXeE1x]u}t-$ËUe3]u}]Ít&|1ۅt$|D$D$É$莙UύEȉT$$ED$g$LEȍD$0@xEȅY{D5σ<$D$ D$D$D$9uw$1L t&'UVSÃ`Ѓ= T$$ܲ)$D$D$$t$1$5\$$xdD$D$$*$=bdD$D$ȳ$茍$@$=b4D$D$$\$ܯD$t[^]Í$Lt$]̍v tD$D$$$%딍vtD$D$ƍt&$裐D$D$T$艌\$$Ɏ[^]D$D$$t&UVSÃu&tt$C$Eu[^]Ã[^]ÍUWVS\Кu҉tL1ۅE}uOv6t+N^u\$<${V6PuՋ]Eމ]EE-&tș#E6FtӅtTu$VEG!UD$D$ D$T$<$gjED$G$UOEЉz<$*ID$D$$袊ỦT$$ߌ6;t&}ԋ]ȅE1&Cu${EF!D$D$ D$|$4$脇ED$F$ USFX4$D$R ‰qXEЉo4$HD$D$$藉|$$׋"E1uȅE UЉ Кt$&\[^_]Ít&VD$D$l$|$D$$Q[E$ ‰xEЉFBtșOU^f$ UЉSpEP$Et&5j$UEԈP!D$D$ D$t$$葅D$D$$t$$1UԉE$OFE Eȉ4$uȅ\D$D$$觇$諉D$;$>wEЉ$,EEE81}]1E14$]̅uE>1ɉUu…t<$fE$ZUP!D$D$ D$t$$-D$D$c$蝆$QEԉ$fEE4$P]̅8MzE$迱ƅ*]ĉ4$<$1DvED$G$QtE̅tSEЉH<$1RDD$D$$$ʅ$EEkGX<$D$ D$D$u$|$0URD$D$l$I|$D$$聇WUUD$D$$ $轻Ewv$=b蔻D$D$+$輄$pUЅ]Љ}-t&PL$T$f$ :U؉T$C$C$wE؉U$yNjC@$sƋC$UxU|$ t$$@T$D$ƺC@X`UE؉T$$֊ƋE4$D$赻4$B}D$D$$譃$ND$Ɖ$_*bNj]ȉ$A<$nD$D$$TỦt$T$$MẺ$UD$D$%5$=T$D$ EЉ$‰YEЉ<$1>AD$D$\$趂$E^}ԉlj4$AEԉ$:UD$D$%5$=T$D$ /<$WD$D$$=Uԉt$T$$6}ԉlj4$@<$ D$D$$Uԉt$T$$Eԉ$脃UD$D$%5$=T$D$ y$ xUEEx1@E1}Կ54$?Eԉ$ UD$D$$5$=T$D$ EUԉD$B$$L1UԋED$D$$$݀$!}Կ54$'?D$D$$蟀UԉT$$܂Eԉ$5UD$D$%5$=T$D$ *$ )UEx1@E$ UEPU@EЉ%UWVSLE$<EEЃw EԍU1T$M $lEԃ/E̍vD$D$$] =D$D$$J$$=b} }B}d}} D$D$b$~$蛵D$D$w$~$w$=bk]Ѕ4$LD$1D$$u~$D$QÉ$'tf{u[9U}e} Ƀ59X1<D$D$>$虁:FtK:FtF:F=:Ff2$8M t:Ft:Ft<t&uԍ$t&1L[^_]ÐUЉ$D$D$ض${}\$$+D$D$*$H}D$$D$D$E$}$гTvD$D$$|D$$蜳D$D$$|D$$pD$D$$|D$$DD$D$$l|D$$IvD$D$$8|$U$oM $pUB$kM $E%p\$|$ U$ɰT$D$薲E${D$D$ ${\$$a$yU$>eɉC8 u@H0up4u݋H,tpt0t8Ht1D$D$ ML$H L$@$UCUȋ@D$HL$L$U)D$D$ְ$zt$$UȅDfD$D$E$a$=bE<$ =D$D$ȵ v$h$M $% ؉D$E$ht&뵾D$D$$y$HD$p$t&L[^_]D$D$,$}D$D$$|UWVSl}eE1]Ћu EED$\$<$yyEȉ\$D$Ẻ$z]̅u-t&vStۋSuօuHuIQ(t u҉MEUT$ UED$D$D$B,$܄}ąt<.<I<d< D$D$O$w$ o]t&|$B$0 $űxẺ$X%uD$<$LẺ$1Ee3l[^_]Ð$LxD$D$߱$bvD$D$O$Dv$xDkv$D$qRD$D$4$vD$D$$u{D$D$$uXD$D$$u5yUWVS\EeU1$EËE$D$zE=EC,t.{(u'D$D$$u$KwvD$$X @&lMA(t 0ЃT$$ܲv$ D$D$ع$xt$vD$D$$Tt$vD$D$$$l,vE $}2EċUe3n\[^_]f$|4tD$D$$뢍&$ ED$D$$s$uD$$ UUD$D$$Gs$uUev$t&Av$4($ D$D$$r$uD$D$Wv$ D$D$d$r$tD$D$$hr$t 4E2D$D$$EvD$D$v$ EU{(4UD$D$D$q$tUD$D$x$UvU}$ƍCfK^t&ރ1V‰煼t΋M D$T$ $tvuDžf5@c5D:nUWVS,]\$$xi$@T~ftrC8 upFuLD$Ļ4$Imu#U$$D$gD$D$P$ie$g$"UWVS] }tfD$ D$$d~HD$:$Cbt4xpt81D t1>t4$<8u߃[^_]1ۉ_1[^_]Ív>uUWVSÃ|Ey1t y8qA` D$ E\$D$A$h2t"1E$%a<$-|[^_]ÍvED$ED$$<NjE$`EE1҅۹u9Yv<t9wQ9rqэDFU$$Ut j&FUEċ$%U9ED$|$$;tdEt&L$ALM $D$bD$ǍEԉD$C $:E؉D$E܉D$ EԉT$U<$D$Gr<$荻U$肻8Eس}܉E{fELMDEFEDVD$T$U$cN11ɉMt}fL9r}ME f9 3M $KEUċBPz]uċ]&t6FuM̉L$@$edE;uӋE;CuˋF]pVF(tID$D$V$[a$ca$ D$fD$4$Uĉ$诲fFtuUMD$D$$`MUL$T$$c>7$4&U$U&|5D$ D$t$c`$b6ubTUĉt&tiJ9 uAHfUWVS<$RD$:$DV.9&XD$ D$$XFt <:N<::u1ۋuuLM tE $#D$^D$D$t${X\$${Z<$91<[^_]Í&$ʾUt 8M1uσ} tE $#D$!^D$D$$W$9Z1넍vUlE tE $#D$]D$D$D$W$Y$D$ D$UWUЃET$|$$L<$u$\T7E1?$Su t$}t=tЉGfu|D$$Xt $萱D$u$^XЉO Džt\$$*X$]uHM tE $#D$[D$D$$U$WE$N1N$Rtu$4SÄh薈Y…EKjcD$$8Wt $FD$u$WЉXDžt\$$V$褭E<[^_]ÐUDE tE $#D$Z$DD$D$پ$iT\$|$$VW:t&t }1f3})ِҐE)vf'UWVS<=t5u]獴&D$\$4$Ru} u<[^_]Ð51dEd+f<D$|$E$RuQ? tLEԉډ9|ɃEdEԉ$¬tL\$|$$]T<$U딍t&t+$辫5<[^_]11_&$ tfE$D$]&UWVSEUUMM} EUeE1M$]ۉEt UEEEEEtMt$ $WWD$$#Wm$ D$$#W!É\$$jE<$zUEEEME9t(ED$$D$RQ$ERƋU1$RU҉Et M $RNjEE$RuvD@>‰$ѫEGET_@PASS@PHRA@ SE }EiUk U] uxM $yƉ‰64$\ UGEċUD$$EED$ O $D$D$D$D$D$ D$D$F=M $E$ިuąU$Mt M $>t\$$#U$蒨Ue3Ĭ[^_]Ðt&u<>D>$^EGET_@PASS@PHRA@ SE E}u;UXvM6E$ E}t}E1]Ðt&3<$D$ D$D$D$6Tu͋E](&@Xx0t&E}EUB$sE%D$D$$PN$ODD8$NNjFV ;;V $fBD$D$$EMUD$D$<$T$D$ SJ&}ND$D$<$M$貨EEvẺ4$D$NTME$dD$D$$E3M$NM̉MEE$NECU$EN<$ENM‹ELsMMM$貧4$EAU$@MD$D$$MELMU|$(t$ L$$MT$UD$ ED$L$MT$D$$L$QU$ <$MEȉD$EЉD$ $oLEE&fcD$D$$K$Mt\$$#Q$蔤$1膤U$k$oEM $ $NxD$D$)E"D$D$u$K$cMU8E*yND$ D$xD$N$eIUWVSEu UMEeE1UMt]=MtDžE1҃}t$ D$$E1D$`?t }f)?$4fۣUx?u }T<$}KEExU$. xAUD$B$&xqÅuEtEډEDž|UMM|$$L$R!$Z$UB$x‹A+E9~‹MAp$D$ptMT$ $D$CJxpUU;P|$U%C1ҋ|D9C:9Cu剕plD$D$$q Clp밋1=T$<$pNp$轠9E1ɺt$ D$D$$u&$u踢yg$M$4AUx^^|u}t(tPD$E$D$EED$D$$&U:uBEHȃ9ws+E}f׋UD$$T$ME$L$D$M 29wĉ}FUlD$$T$l|$$D$hv$t&<$DžxMe3 xļ[^_]É$$裞=‹ =:uUԍUEUxA랉<$F뷍t&諤n})MyY ʃMp $M$;D$ll$֝E p\$]|$D$ UD$D$ D$2D$D$$J\$$菧}!$U$ L$=b"{D$D$h$JD|$$z<$M$L$sItn$=bz^$s=$uZ$转$4豝MxC$Nj$ZEE$K8E$7D$D$$lZCUl|$T$UL$$T$ yM}At^Q tW;tS;QtNf9 '$=by<$7D$D$$B|$$y$=bxy=tE1щ $8ǡ<$D$DvE‹8XC"=D$D$$?B$CD$uWM]AD$D$ RD$2D$D$E$D$IG\$$Ť=bD$D$$A$D$u}1tUfqD$D$ǿ$cA$ۿD$迯u\$<$Gu|$ ;5|D$ ;D$D$N$@D$+D$$NpD_D<$5D$D$$蔙<$茙Džx'UWVS,U}u ]tt  t.M1T$ 1҉|$\$4$uD$A$訙ǡ<$D$9Bt?u$t&˨,[^_]ÐD$%<$U뵐&UWVSl eE1]} E)D$$%k<$?D@$CLEA@R_PA@SSPH@ RASEf@ @D$D$D$D$D$ D$\$4$-$詖u54$Uąt Eĉ$Ee3^l[^_]ÍvD$D$$x=$|?4$*Uąu릐D$$ۍMEEEEEEtM\$$PBM1)$;1躗MCLEA@R_PA@SSPH@ RASEf@ @]ÉuΉEt&>$D$ D$D$D$Au͋E]u(Jt&ẺD$EĉL$$fҍ_MT$D$$GLU\$D$$ G1ۉ$}EEUEt`Qt&$ 1%|$D$$D̋$1UDTUEU؉EB$;EKu1v똍G$}fE\`$NUT$D$fE$EE$t$E0&E$诔Ƌ$cP;UUfUFEUD$ E$D$FD$/E$T$:6Et$$D$P3UB$l9 }EfGxG1U$:11v}D̍t&~=U1ۃDE$o}EƋ|̅t9DFD4$|$D$.:t<$ku}D$D$ $^8$:ED$E$mffGxFG5EE9EUD$ ET$T$$G$ƍ\`$4G$9|G$VU$T$ËED$1D`hD$D$L$x7$9&D$$lEU$T$D$i$qD$$ PVPVP V @F$fGxG5D$ D$D$d$5D$ D$D$d$5D$ D$WD$d$5D$D$w$d9D$ D$D$d$|C5D$ D$ID$d$5t&'UWVSueE1t ~1} DžpN81ۍFMV`ElhdEv~1~8F4C $^4FtuD$D$$,5|$ \$$c7~4fuUu E u $ ʝUe3[^_]Ðt&F$Lu|`1t&$ƋUB$9|ۉuf;Fx PE9E bED$D$T$-4D$D$$4\$T$J6et&$Ԝ$vF<$ f^<D$D$$3\$$5{t&D$D$|$c3$5If1~8g} i] Džpg="E DžpCUT$4$1EE~0u F EF$EEpD$lU\$L$D$ F4D$F$D$uMyD$D$F4$|C|D$C $D$$t$$|`FL$D$hD$~ !F$fDžztE\`t&x$(hED$$(NjEW ʃ9$|$"GFE||$D$ F $D$E4$D$QNj$-ED$D$4$~ 4$ԉ(fzEtB$9Et| $zf9Fx/`4$T$zFMD$ $D$`$謏 FM L$]4$/ED$ -D$2D$D$E$D$n5\$$E F$oXNj$&ML$$ &1҉EvTUTf U\X$ XL$EEMD$ |L$$$,\~5}fFxiD$$ t+EUtT$ $D$ t$ EMD$T싅t\$y\D$T$$*fDžzt $ Vx~ED$E\$fM\fzELtMLtfVf VVf9zfNxfVxf9zM $褆tfDžzfFx$/VxfDžz$/fFxfDžz랋dT$F$`4$L$-FD$D$E$r`$]t8&ED$$EED$[t,E)EËtB$9|ttfDžzfFx`1 $F1jEUD$$fzfFxD$ D$D$d$4>+D$D$9$d//D$ D$cD$d$4*D$ D$D$d$<*D$D$v$d5/D$ D$D$d$*USÃt;@(t:C(u*$xC$C$[]D$ D$9D$$"*&'UWVSlEeU1ҋ] }D$,E${E@(t w$E$EtU9C D$D$$tWMT$WT$$+fK UD$D$$~ME1}ljEM$t&B0B RJ(79uvS JuJ(;J,rΉ$莝u֋UEM}T$T$D$ $U$WMD :D eEMe3 Rl[^_]ËUD$B$UD$ T$$Z%u뛍vUM1}ωMU3B0B RJ(79uS BuJ(;J,r$kuD$$mUB{ $)D$D$ $'t$$4*G+UD :D MAtUM$T$L$E@({ D$D$@ C $C MD$ $\C C Uz$$MƅE@]$D$ \$\$UD$\$B$'MQ$)Efx$\;(|t&$訊$6D$([vUD$` T$C $D$D$$X&$(1&D$-$`vD$1D$$&$(&7D$D$(K)M$L$)D$D$e$()D$ D$D$$L$D$ D$D$$[d$U8U ]]uE}u} t#t~1t]u}]ftjL$t$$ԛt5Ҹt$1tT$ Ut$t$ $UU1띍t&1Ҹ뎐t&!1{D$ 1D$+D$$<#UWVS,EU ]}Et)`1t ,[^_]Ð,[^_]fUr$x},yv*C0C SS(7,KuS(;S,r͉$轗uՋEH ZGt$D$<$(%UB$Utt$ |$|$$M1Qtt$|$$1U2,[^_]fEP RWGfPWPWP W PW@fGUU7}܉%vC0C SS(9uvCuS(;S,rω$诖u׋}܃M7QP]SPSP S PS@A fCf]S$ MEQPWPWP W PWPfW7] KJHJHJ H JHRfPC$^E`1MUMBAGAGA G AGAfGMND$ ?D$D$$i D$ ?D$D$$s[ D$ ?D$D$$<7 UWVSM eE1E]}utt11Ue3UĜ[^_]fEK }CtT$Ut$$UT$ t$t$CU$Ut$<$T$苙¸w1pt&C$-$EӹECP;PFLPCP;P MuLPC$D$C$UPU‹PUƋP Uʋ@D$ t$t$E΋C$0C$5CD$t$<$芘t ${Z!C$_1c1VvU$)U@EECEEAEEEEEEEEx UMD$ RD$ED$D$D$E$#ED$$+fEx <$EEEED$yUM(E҉UL$$MD$MD ЈD D шD Ӌ$ y D$D$$  ICL$ $L$\D$D$C$1CUtM$L$M҉L$UEM҉L$L$UD$ C$C$ME҉D$<$L$mUC șE5UMED$$UMCuQ$D$D$CP$D$D$CMP$UMD$dMUD$ D$rD$Q$<[D$ D$D$Q$m7L$$$'USÃ$șv TuPXt1$[]Í&$Umu)D$ D$D$$ut&$[]Ðt&D$ D$D$$tD$ D$ D$$軫 tD$ D$ D$$薫U z$t&UWVS1ۃtD$T$$iu$#s$D$#t&;u4$"ud$$,wXM$e'vDž4$躜$jt B$E$*g$g$g$}Ue3 \[^_]ÍvltD$D$ $ \$$D$ D$D$$]=șgD$D$$R $]4&D$D$_$耓v$ D$1D$ݭ$ \$T$$Džu"$=vwgCPvD$D$d$= $*&4D$D$s4$v4$(vǍDž1EPD$$T$ 1fD$D$ D$$H9]WD$$ [DžMD$D$$ T$$B Džv$D$D$$ \$|$$ ]H B=:tB ș-1BrDž E%t$$;zD$$(4$1@p1Dž ɉl$9_D$ |$D$$9<$D$D$d$B |$T$$x _$m$5D$ rD$4$2wlj tj~ 1t&t&1D$ D$D$$9=,D$D$D$NT$$ @pDž 1 Džl UWVS< eE1u] }tFD$D$$$ Ee3<[^_]Í&0$'DpD$ D$D$$ЍdD$$D$t[ڋ !%tꩀu)ڃ ƄD$\$$&=D$|$$b*$j$$ $(T$D$j$Mj‹$ $(T$D$1$'oD$ D$D$$葌WD$$&D$<D$|$$tUft$$ &'UWVS|eE1șDžmDž]1 󫍕׉@DžDž󫍍h ױ 󫋍 $nD$ D$D$$44$r$tt$D$$=t@L$D$s4$謊1EtEt P "DžD$1= $D$ș$^‹EBBGBGB G BGBDžL$$`7$[Dž$u9t Vf ]1҉UDžDžt9EtP t DžhL$D$$*t&D$L$4$xtGD$T$$-{uDž$e$D$t&9u4$h$芑t @$Dž64$舏$dD$D$ݭ$\$T$$Me3 u |[^_]at&4$E$Y<$Y뼐t&o\t&$\ǡș#҉t~GgD$D$D$|$ D$D$$cEP1A xD$$DžD$D$$T$$Džt $DžAX<$9X4$聍$CcD$D$H$)\$$)D$D$_$^D$1D$ݭ$P\$T$$1ۋ$i4$h$蠳$oUe3[^_]Ðt&ut&z wPzt=șDžTut&z wcPztD$D$4$'$k,D$D$'$LT$$2& DD$D$$H`TDžP bD$=b$4\D$$ptt&Gx$D$\?u!P#T\$t$D$D$1=D$ $Z\T$Dž`D$_$ ^HًDD$ C$D$T$r$emt&4$evL$c&D$$Zt&D$y$vL@D$=b$Z)DžTD$,$JPt&D$PD$$PVv$XD$D$ƭ$L\$T$$DžPlkD$ CD$wD$$ vUWVSUEu]1҉eE1EEEEEElj󫍅Pljб Elj|бzV1҅…n}t$&M tLș t=3 D$$ED$ D$D$$j=șM1ۅg$ E$D$D$ƭ$t$T$$Wt&DžDžDž}ED$E$萿1ۋE$3c$kaE$E$5iE$BUe3  Č[^_]Ív$R_E ƅD$$ίEUt\ }t"t&GD$E$艩?u㋽M Uu tșv Džt&tET$D$_$SX}=dM tx4unEtgD$ |$D$$a9tG<$ףD$D$d$I|$T$$&EP|$T$$z&} șv.U1Ƀ=!Et$T9 t$ET$)!St& D$D$$1$T9Cu!C(;C,sCC SC(t卶$CuˀDZD$ MT$‰D$1=!ЋU$E/E$]u$$,K84$(Ɖx&~<$d$<$x$|$\$t!L|$ D$F8D$$^=ED$D$po$TKuC(;C,sKC SC(tv$XBuΉ${\t$$i1ۋDL$ D$*t&b`$D$D$ݭ$\$1ۉ|$$Y&x1 (T$D$s$SfED$D$$SAt&Euz wPztD$D$$$C辟$t& [}Etu1҉މt&x1t x8t)?t3Gxu@d$;E~މEf?uҐt&ډ󋵘t }UED$ D$D$$\ t&$a$9$ЗO\$D$x$&u } ЃD$UT$$m%tƅED$D$po$Qt&ED$` EED$E$Q3vD$$(UvD$D$'$T$$D$D$$$Qt&( T$D$s$Pƅv$mË D$D$ݭ$\$1ۉT$$vD$ D$D$$\Z=\9R<$D$D$L$|$T$$ $W?ED$ D$D$$Yt 1 t&DžlKUHuUu ]}}4$U $#t$UD$ RD$D$T$É$\$<$+u]}]]u!t&UuƉ]D$}D$$&T4$ ^D$ D$D$$N$*6$utEԉ$dt$\$3@dt$ D$\$$_$U$'0I]u}]f$U_t$D$$(m4$ D$D$b$V\$$V닍t&d$袉d4hTlj󫍅hD$D$_$cM&'UWVS,ueE1} ~8t& D$ D$D$$M91Ue3,[^_]Ãڋ !%tꩀu)ڃ u_ƄpD$ D$D$$|LdD$$D$cAD$D$$t$$ 'U1WVSudDžPt E PP$ZT$3$PD$TEЉ$T$@N^1E~)E }4t&<$D$tE䋕PD$T$ T$D$\ËE$LT$R:ļ[^_]Í&T$ZRP$D$D$b$\$$ļ[^_]Ðt&tvD$1D$X$$ļ[^_]Í&T$\$D$_T$I}US]tC$][] f[]fUWV1S<}D$D$߱$ED$D$$ED$D$$ED$D$$ED$D$4$~Eȉ4$OD$D$$W$ E$D$MeU BD$D$$ $"D$uD$D$$$,D$0É$P!$G/$l$D$LG ;$JD$$D$$XH<$농t&0< vEEEvD$ D$$ܿE$E UEU}$D$D$b$ݿUT$$|t$$rD$D$$蚿$D$F-$RU܉p<[^_]f<1[^_]Í}}}} UE UD$D$$|$$uE$D$U$T$uE$D$bU$T$O]}u,D$D$X$l$ pvEEED$D$}$.$k}tUEUEE܃}E Et&'UWVS˃*UWVSLM]&ۍv Sur4$腪EF$4$蜚S :t/UԉL$|$ D$T$$.4$ÙD$D$L$|$$$4$ED$D$5 $ۥ|$$$=bD$D$4$wB$=b[] vtRC8 up$+V08F4eFL4$D$#$=buL[^_]Ër4$=EF$螔4$SE :tA UԉL$|$ D$T$$=4$ۗD$D$L$豤|$$a$U4$蝖D$D$5 $s|$$#$=bD$t$$A$=bD$D$i$$ D$&D$D$Lƍ&'UWVSÃ1t711tt.ޅtӋKuuޅut&[^_]Åt΋QRwD$D$$U$虥눍Ut31ft"P: uRzuz,tuf fÍ&D$D$$Т$fUWVSӁRMrVL$\$$U<5EtFE C%EtU 4$NM $EEFET< wE t 0EF<ȃXE><҃@҃N< ЃPɃ2 MЉɃ, M~E O}0}ċMĿx MT$UԉD$EЉ\$L$,MT$D$|$L$(M$JL$$ML$ ML$ -$%I?tAE$EUЉ|$D$ẺT$ D$C@$/?$E@E$IUȋED$D$T$U|$D$ D$C@$D$Z_$EGC$]^C$Uԉ{tL$LËE$D$ZCUԋB$^UԋB$EԉX]E<$胞D$D$$i\$$D<$LD$D$lj<$0D$D$x$\$1ۉ$E1$h?Uȉ$}Wt uЉ4$nWEă\[^_]É$$8D$軛$?Eȉ$4W빉$$D$芛͉]|D$ D$ID$$l`D$ D$JD$$<&UWVSÃ\t11 t&tH9 uHut8D$D$\$Ș$|EEЃ\[^_]f$D$@@$D$rUEEȉ t&t*P: u@ tRJ…҉Uuېt&KEtOE11$ftt t&tft(Ktt1 uԋCq%ۉEu؋Eȉ$uUEЃ\[^_]fQE܉D$$UsU렍yE;GuE;GuGw1~;Ee\wiFLEċ}1D$уL$Eĉ$UuD$D$$|$$[<$UD$D$G,$U轱U81}D$D$ EȉT$D$t$ D$E|$$U踧Uu$UEGC$YC$.U{E.D$D$G0$UD}"E$$8D$Eȉ$SEvUS$]D$C,$&D$C0$&E t#EED$ D$D$$'$1[]Í&'UWVSLD$E$D@@E܋EEvtHuQz1tR8vՋE܉$XD$D$$輔$pEE]C8v1$1 D$D$$O$$9ht&HeD$D$h$ $D$D$$$D$uSD$|$D$\$ D$D$$HDD$8D$8$W$D$qD$1D$$$EE$$t8L[^_]þE4$D$D$$輒\$1ۉ$j띅!C8p~1tF8-U$74$D$_\}5EU܋B8==D$D$$$ED$$[5EE"t&U؅}G8tNf1ҹɋ?u3ҿUԉ$c4$[Uԅ!at&tɋG8u@x1tP8vP4P8SP<$誑<$D$$J~<$臑<$D$$=b{vtD$u\$$e\fE$,[^_]Ðt&f1^UWVSÃLUEEp<$tM~NStHt1ZщT$D$$PuCHK[$=bL[^_]Í&ɍut$\D$D$Ԯ$脎$81ɉ]ȍ~Eu&td<uF$ODDVcG҉T$$~uEuEԉًuЋ]ȅ$D$D$$詍$]1ɉ]ȍ~Eut&td<uF$c<Vc҉T$$~uEu}ԉًuЋ]ȅ$D$D$$ь$b1҉]Ѝ~E&td<uF$^|Vc҉T$$~uEuuԉڋ]ЅCH<tF$D$D$%$$CH1Ҩg'$=bM̅U̍ED$D$B,${t UZÈ8$2D$D$D$Z$D$D$D$6$ތŨ[ft $,$La$WwD$&t $,$L$WwD$t&D$D$0$舊$<&$=$CH$,$\$WwD$vE$,EE$,EmE$,ED$$WwvD$$WwhwvD$$WwP7v$V<CH$]$&$[$WwD$&$D$D$K$ $E$D$$=b西VVVvdV$,vUWVS,UM)Éȃ1E vC8 uC uMpt UStӍvUE܅Eۅ}tEt$$$;D$߾C N,|$$t躾FD$FL$ȿ$=b蜾UI}?Uzw~Dv}ufRfutP:t11ɉ}t&,[^_]$]&|$${AD$D$4$#$׽f|$$mt&'UWVSЃ\P4$D$#4$ZEp1E t&tP: uPuMD$<$Z@@$D$4CKEEȋtP111&ttt tt,Kt"tE uЋ}ԋqt1C uϋuԋM̉ $}ȉ<$jCEЃ\[^_]Í&QE؉D$$UcU댍IE;AMoE;AcASJNL1M}EUD$$уL$rMċUyTD$D$$|$$HU<$UUt&D$ D$D$4$X 4$EUU$U$ED$D$l$j$D$<t}4$EgD$<$!@@$D$@EED$D$$$(EMčED$D$UA,$茞Ut }}zE̋MȉT$UD$EĉL$MD$ D$t$ D$ $膔UU$MHKE $FK $EEUC E|$$诹MEL$$轺$=b葹U}tD$D$$谂UUD$$VUt$v{$8D${}ȉ<$@Ẻ$5EUD$D$$.UyfUWVSЃl4$*D$#4$VE4$21E t&tP: uPuMD$<$@@$D$\>SEEċt`11E,vtMԅtt t|t1St'tJ u͋}Ћrt1C uϋuԐt&Eȉ$} Uĉ$>Ẽl[^_]Í&RE܉D$Uԉ${느RE;BUrE;BfBVMVL1׃$D$уL$蜡UEz E8U$T$U}$FʶD$D$^$$nD$UȋED$ D$T$UԉD$Et$ T$UD$$ː$EGC$BC$C}{tUȋB$ E@U$ED$H4$@S(D$4$ E@vD$D$$~$D$<<t4$ED$<$@@$D$a;EEjE$D$}U$* NjEȅxGEEGuhUȋ$T$U襄uۋEȋPt&GT$U$腄UuE@GGE딋GD$$D$QEs}NjUB$tc1҄t -%}y&9D$D$$&}UT$$cUȋBD$$.D$貳UBrEVT$U$T${UB}‰׺/$$8D$~Eĉ$:Uȉ$E$EEw'U1ɉWVSÃLۉUu 0t&tP: uPu3OVAE]6V uEEBD$PL$T$МUT$Ủt$$ÍED$EЉD$ D$MF@P0u@4D$D$$"{ED$D$${U\fF 36t&EԃL[^_]Ðt&UtIUD$D$h$zUȉT$\$$NE3t&}t^D$D$$bz\$$$*et&D$D$L$(zED$D$$z렉UD$D$D$yU9&D$D$i$yEEUE uE @2  yT1fUWVS,U E҉E~$10z,;t?C 50t,D$E<$D$~uˉ},[^_]t&,1[^_]Í50UWVS|Eċ@@EB@$D$5]ąۉEExw! fP: uRzDvD$1D$$/Et-]1t&C8 t8ut Eĉ$+E$5M $赴|[^_]ÍvC t‹pF0tdD$FL4$D$D$D$$wt$$y4$|gt&E?t&N@9ȉEMEEEEc}M؍MЉL$,MD$ED$( D$$T$ D$ED$D$0D$ t$L$$q$=UP$)D$$D$ $t[C]ċ@@0>MD$D$$EcvUM)щL$$xV@Mt$ $v$낉$D$D$G$u\$$wUWVS|D$EĉUD$$蕲EE}Ћ]ċCPU ftRC8uC tpV(tb4$jyD$D$$Put$$ufEĉ$=E$ұE|[^_]Í&EUGG GE؋Bc@$D$1t$ |$,D$( D$$D$ ‰D$EUD$D$D$ED$(D$$U$2u@$UP$D$$D$E4$D$D$G$t\$$vU$薰UWVS|,EUMEEuEEu:t&M t H] fE̋EJE̋PuRUĉ$D$uĉE4$(҉EP]ċC(}s\S` 1E0$=b艩EЉ$EU;S`C\D0$>D$ǍED$C\$vU$|EtsD$D$d$SrMЉ|$L$$C\0@W$<D$D$$ r$迨"f"놐K` t&D$$tCD$fEC$Fa$eM̋Qq ҃*>t/uԉT$L$D$ t$|$$( $dD$D$L$>qt$$$C({$$TcD$D$K$pt$$蚧$莧$`D$D$8$pt$$\$=bPŰB8=$,[uŰB8D$D$$ $=bE̋E}$UċEуCM|[^_]ÃmZ$oEC$M_$cM̋QqE ҃*>tA uԉT$L$D$ t$|$$('$obD$D$L$Eot$$$$1aD$D$5 $ot$$跥$=b諥{1w{8j$L舥D$D$M$n$dCL<t$1fD3M$D$8CL9|$=b$&$`D$D$5 GMA ZEyEyC(&C$-xC$9$ _D$D$8$Em|$ t$U$T$g<$f$^D$D$) dD$u$e D$=D$D$L$3mML$$$=bԣűF8D$D$$l$蜣|[^_]þ"fD$4$((EM $;n)ƅD$D$B$elUT$$D$ut$$eMBuEEEt&NƒҋY UT$$nNKL9tlLT$ D$D$$nS0kC({$G ut&ESM;ECEЉ$UM}_U|$T$ML$UԉT$MЉD$D$$L$ 9hF8$:D$p$ D$pD$D$$$?6E] C8 u@EpEԅD$$guԋN0EԋP4E={uą8uD$D$$2gb$Y轠D$D$^$i$虠$=b荠dAsM@ 8t)$<OD3L$D$: tD3L$D$ ~vҍf?v$iD$n=${T$$nC]ȈE$rD$tnKD$%$euԋVFD$ F D$$D$e$:D$n$:D$n$:D$m}w MԀyDEԋp<~twNStHt1ZɉL$ D$D$Q$d?t+$ D$`mNSt뗋UBH[uD$ $d$:D$muD$$t$cdEԋ@,Uԋz0Mԋq4ulCuJu/$:D$l$ D$l6$mD$}l뺡$sD$flC뜡$eD$Llz$rD$2lV$pD$l.D$$oc$eD$kD$$@]+[@f@.]@ $.Q@Ή4dӈ;‹HtJJvJv0 v\)ڃŃd|$$u;4HH$yPHf>$@0U0$0ll&P:uRzvDžPD$v4$n"DžTQh $9ND$D$D$D$$MtT$$蔄D$D$$M$XD$hu F@N t $g/D$R4$!u"DžTt $1D$D$X$4M$4$D$D$$M$?D$诺)N t $赥Dž`Dž\ilj$貰D$D$G$L\$$NPD$ mD$D$$nKv'UWVSӃ,RrU\$$T$5}?C1ۅt E?VT$V T$VT$VT$VD$D$$T$ Hf~D$z\$H~t%<$KMD$ :|$D$$ `<xD$ FD$$D$nHt4$H,[^_]~$M %C1ۅU uC1ۅ- uc!FD$ FD$R$D$G U1ɉWVS|Eu2&tP: uPuUċB8 ]ľt&t{t&SK%C tFtڋuD$1D$$I$葀|[^_]Í&ut1t&닍AE$lE@YM1A@$iMD$D$ $OI\$$]ft*SK%C tҾu$=b].C tCMċxD$ \$ $ ,@ɋPB@BD$ B D$$D$ED$=b$EE1ɉD$D$$Gw<$9D$D$$ H|$$~D$D$$G$=D$葵KN&]1K tNtrCtfuD$D$ $fG$~K uq$~FL4$D$$=b}u18t4q$}FL4$1D$~$=b}uǾvD$D$$F$TD$L&D$BL$D$gD$D$.$EKFUT$$|M $ uU<$8GM$:D$D$L$EEUMD$uT$ UL$$T$|vAu$Ea|E$8‹EU$::D$D$L$`EUt$D$ u|$T$${vAE$E@T<0${E$p7‹EU$9D$D$$EDUMT$L$$X{dvD$D$L$xD$gD$$LD$D$$ E%M1}ЋAˋ@E -CtC8uED$ \$$1EtUGG GCU؋@EЃc$|萝‹C@$UD$&GUD$D$$cC$E2UD$!$_@UD$ :BLT$D$$WD$D$$BD$D$$BƋE2MT$|$,D$( D$$D$ D$D$D$0D$ AM@ $UD$ED$[U$ME$QD;Ptp$藝UP$胔MD$ $D$UċBӋ@EM $~$pCQH;PuUB@@0s$_xEEu uM$4EE$6D$D$L$EDAUMT$UL$ M$T$L$wE KD$D$$@EEQD$D$$@E9$謤D$D$G$@\$$BE$'}D$ D$D$${b?D$ D$KD$$p>?v'UWVSÃ$D$̫E$UEډD$E؉D$ED$ M$E觛eD$D$$G>$D$C=$`t&D$1D$3$=$t<[^_]ËU܅D$D$$=$D$t&D$D$$=$D$<D$D$$W=&'UWVS<MEU e]1ۅɉT= HEEEEutvE1ۉD$ T}D$|$$D$:tsE$/E$$E$iN$aMe3 :<[^_]Ã=tD$D$X$E<$I>덋E_tE<$oEtEE$\}t6}5}Dž$Dž3U1Dž(Dž@,Ћ@@$=bD`r@23%,1D$$$=brHDž@1G$]?É$k<#ua$u$2 1 xD$D$C]$:$_D$蟪hw$k<#tLHuTLDž@Et&q$螕>&H@t&< 0< 5D$ $a7Džt)D$D$R4$+uO>u׋DMP<$D$ TT$ D$E(LEfD$D$4$uDžTbD$D$az4$DžP0RPz`L$<$TGmDR`;JFd;J1PWOPx@ BD<Dž88 88I8A8u׋@;Huɋ;HuJ:Hu9uDC4tP|$D$ L$D$\$ |$T$$'$qtCF$F$o8^'$uqt$D$C8B$38A$n8X1hfD 8҉TR1D$PLT$$$aED$E$%$,yD$D$D$D$p$I<$~ $輂$Y $o@D$ D$D$<$es<$藢?6vCP2à u‹C =M$.u9ft& &$.P uĿ넍vCug@D$PL$T$|K $D$D$ $ot$|$$4$3;tC8 tuE&C5$-u$-P2t$¶ tQCu@P4$XfD$D$ $Xt$T$$f$(-vEt&E$U2u$<EUED$$YÅ |uL$4$|$}U|$lED$E$ EwUv9uEl|$$ $sDM $&D$D$ $Lt$|$$Hl4$ ut&EfM $D$D$$t$$+BD$PL$T$U$fD$D$$XX|$T$$<$F8DED$D$ D$D$E$A'E$20f|4$D$D$$\$$u$D$D$$ $$ t1ۃG|$+| $X|F$Ƌ|$X|$ t$$WT$D$t!C@PLD$LT$$\L$ D$txD$\$ $HxxD$ \$<$ * @xD$\$$w`A=GP1L$D$уL$ǍE$`\ D$D$$\|$$T$S<$56&B@$詨iCPzA8NPu MB< <(<<<<0<(M $D$D$ $XXt$T$$HvM[VU${D$D$ $t$$C@E@Z$U6|4$EED$E}D$ ~D$D$E<$}D$D$ED$|$4$fUtBu1ۃ&4$D$ D$D$D$6;]r͋E$vUf E$LD$;M$EL$=u4$i3f5fx$&C$t t1ۃG0x$D$Ɖ$J=~24$qD$D$'$\$$E4$D$xQ$=4$D$D$$X~X|$T$$t4$<8t|GB<wG pt,p$1typE5E*u4$迭Eo fB;EfZB;ENED$\$$r/=$j<E$XD$D$ }<$D$D$ $t$$VC8P]}<$D$D$D $t$$ N$;D$D$x $\$$4$YfnxD$\$$q=hM $XX D$D$ $|$$A|$D$D$j$\$1ۉ$xD$\$ $p2uxq|$HU?HE9G t&WN}ftUJ=  ]}<=M $D$D$$lEȉD$<$'$9ƍE$MD$D$ $st$|$$ol$1Ou4$8$$ƉD$84$-|1G ;E(}tREH=t?U$D$D$ $XXT$$G ]EU$=M $@D$D$ $ft$|$$4$*-O=u}x>|$D$D$ $\$$BUx=}<$D$D$` u4$jD$D$$\$$BEȉ$ E$ MuEEx uEɉ Q ]f6thV t^uBx uEu1t&#S uBx uڋVR$T$蘊u뒋x] ɉ Q u#\6V 6uBxuڋE8uTt&?FW 8uBxuڋVR$T$u늋l|D$t$<$BpE$D$D$44$#UD$$ÉD$KE=mM $2ǍE$5D$D$4 $[|$\$$<$*xʋ}0]f?GuG8 uuۍt&C8 u@D$G@$uыG8  C8  S uS uB@<(t<tԋ7u%+t&@D$C@$+t6tF8 uى$q"D$<$ƉD$ NKErxuʋ]>DžpE"։] 6NjV: uu<?t'G8 uRT$@$9VӃ: 4UBEu t&t&t؋t SuÉ<$p!D$$XD$XÃH@O8t!?tG8t}pEًx]E19}]t{6‹N ut4 t&t%C8uVRT$@$uً벋hED$Mĉ$E놐t:f t(C8uVRT$@$uًGhML$Mĉ$~VE]Dž`t#?}M}GuGu؋xu σt0tċSuBD$G@$ֆt SˋBD$G@$&uGt0t+D$ LD$LD$D$ &=s/&hUUt)MMsuؐ}t.}W t!tt[tP tu$D$ƉD$h$"hNKEUUevNRy;zuy;zuy ;z wI:Jz2`dt,ED$ED$ E D$D$Eȉ$5.pu"}u}fu}u}t&@EȋlD$ $}t t&K==4tEċpFEFEF8E~F<]*t5p҃}у} 1҃ |Tl<$EUE$萟E@x fx?MD$X $*XIE8sM $XXD$D$ $ 4$8UD$$ljD$OE=BM $D$D$` $|$$D$D$$xrM $$D$D$4 $XFXT$$!D$D$X$E$pp2}ă}L}}V}4$j!G$},l<$D$D$$St$|$$O'vt|11=uNU$M $込D$D$$t$|$$ 4$ tF161{xD$ +D$"D$D$ ljUlX $^M}u] $%ED$ lD$D$D$t耵D$ZD$H$DϹD$ lD$D$D$;&UWVSÃ,EUM܅EtME9M؉D$ED$E $E}EuaHE,[^_]Í}E1f4$#$pEڋM؉D$ED$E $84$E}C\$ D$D$$;utE$\$$BD$;}$EE$Jۉ@菰$D$D$ݭ$觴t$\$$裶느UtIEfv4$B/땍$lIhEt&{E"vE؉$E؉$9l#t&'U$t$U M]uEM 1ɉU1҉u]$t$]t&UEUM EE1E h&U4Eu}(D$ (D$E D$E$謇u}]ÐUWVƃ@eE1r%wOB8UԉT$@$ѱv1Ue3@^_]Í$` w̋B8t&U܉T$UT$@$w뽐t&F ;EuF;Ef }k }vUԉT$@$8&U܉T$UT$@$Wt&'UWVSEEUME $C1҉EEvu1$w ]EE t`Uč{<$D$7u$#WD$D$h$E ]KVt&u؋CCu&S:CM؉CrFV~ EUԅH9S]]ĉUfPtu q];^tt`H9tXԍt&];^uPU܋RUR.IQ~V 9wXE]܅uE܋]ċpFt{uNL[^_]Í&<Q;=A;Ft&vKt&U؋:yD$D$F,$uv $n9E rRUJ@U5M;*#]] S҉UQURc] WS~}U 9Up t&tQҐt&u;HV EMEHy}] 9 b9U $f9U vfovUWVSLU] uB8WC8 o>}CUЋxO@GHW4H9u1҉މft2K9u*Au$zF@HHuӐt&űMCUЉ@@HGEUE̋B8U܉T$@$1ɉD$D$$E3*F8]Ћ]1PJ;MVMtVuUЋRRLUԋ@$MwMȉL$ M$D$L$4$N6t F8lE}̉8L[^_]Ít&O0bxT&1UЉ@@HL[^_]Ít&R;U#t&Vuy f}ufMMt&D$GD$GL$UUȉE̋G04ukD$D$$U耞UȉNjMA@$Uc|$ D$E$D$蘠M̉ $CUfD$D$LD$D$i$Uȉ1x1fPD$ D$D$$pۜD$ D$D$$h跜D$ D$CD$$p蓜 UWVS,u}4$艄u At:Ct0 uE\$|$ 4$D$ED$E D$uƃ,[^_]Ð&U$^ÍUVSJÉ%tft;Pu;Hfu[^]fPVPV [^]ÍvUWVSӃ,t:u ftt(Sut$B$[u؃,[^_]Í'UVSH^t*^ vt;PuH; u1[^]Ðt&P@PH=H~74$gD$D$$荛\$$͝[^]ÐUS]aPSPDD[]ÍvU8U uE<1t$H@1 U8]Éu։}ωL$T$$[OuW9>tC^D$D$<$踚|$\$$贜]u}]S5v]u}]Ív$xD$D$ $MEXUT$ M\$$L$J4YUVSt#tf$u4$[^]Ð&U(]Éu}$=u]u}]Í$3[D$D$l$虙|$ t$\$$葛]u}]04USTZu[]É$RD$D$$8\$$8$US]D$r$&mu []Ðt&D$N$mtD$|$ltD$$ltD$$l҃닐&US@D$D$$C$臚e$D$r$f\$$ V$JD$D$0$$&[]ûkUSD]eE1EЉD$$lht?D$D$d$\$$Ee3uD[]Ðt&E܉$ʚUhuu]]eE1ډ}guKE;E tE EԉuEe3]u}]Ãt ~1׍t&uf1߹PE 4$EED$ED$Ζ|E $D$EԉD$-E;E SfvE $D$貙&'Uu58eE1@]<}u68\$$_XtEv Ee3]u}]Ívt{>TuLƍS5 t/48D$D$D$8t$$xaHu}qfD$t$$iI} uEԃuπ}u}u}u}tD$E|$$͘vu<$JD$D$$lT$$視QD$D$$8t$D$#$kD1$st苽1 󫍅$t$$ti4$cD$D$ $艓|$$ɕ4$1D$D$P $Wt$$藕Z$$D$$$$$P듡DBD`r$$,D$視D$*D$$Jv'U]Éu{$t$[t"u,> tF!$ D$v؋u]]f$P$x D$P؋u]]Ít&UWVSӁ$`eE1WUTGPE؍tdUP E}d {PuӋEEC$EC(Ed`EՍEtUe3ļ[^_]Ð,vڍd1DKSDžt E MJMJMJ MRUU؉E؉UVT1JE 4$EpD$ED$E'vUSDeE1EU1tuEUe3uD[]Í&+͓ؐ'USDeE1EUs1tuEUe3uD[]Í&*ؐm'U$]u4$ 9sÉ؋u]]Ít&'UEE'UE?wLÍv'USD]eE1CMt<Ue3uRD[]ÐUY@v)1ˍ1t}x CM벐t&CML&UhEUuu]]EE}} UeU1҉Ee1UvtEĈtEȉUtE̋UEt EU}t E‹UtEÈEe3u ]u}]萑U$yMtpLÍt&USTeE1E]u5u\}u}tHEEt#v+(1Ue3uLT[]Í&1t&E$ D$E$ D$}xy菐t&'U($]Éu}Q\$Ɖ$#ęu:D$4$ 4$aÉ4$K؋u]}]É$$6|$$wD$貎ę4$D$ę몐$@$D$D$Z$\$1ۉt$$jt'Lv;4vUW1VS,$ueE1Dž$@$$$dƝDž t9D$t$$?uME u؃}tԉEEu EtEEE똃=t2D$D$!$覊|$T$$܌=HX_$#t? ‹dFH ft%C8 uP1ɋ$uۋCt9@w;s4$je?MA5H|w85=D$D$!$腉\$ t$|$$轋=|P|Dž DžDžxDž`DžhDžpDžtDžgC9(sbeuxxWC Dž4$t&NjC$|$D$ CD$C$"D$<&tpvSh`Et$D$ GD$C$!D$ͅPO TDž t&4u=XۋT$C@$D$?|$D$D$$D$ @ fC8 uS@pfumu༃qD$|$D$$D$D$ D$ :~t$C@LD$$$:D$$ D$<ۉމt&1udtZC8 uPCuu tٱ&F@ $2ut&utzfvD$D$(#$fx`hpT$$tL$ \$t$T$L$\$ t$T$$P|; Ht+;dDž| ?G8 uGtt$@@$\%t ft9Pu;HtuuPNjGG@@$G@@$vG@@@hG @@@iG @@@lt$Gv||f;|@95|!|?DžDžxDž`DžhDžpDžtDž$sD$D$p!$\$$lt$$蛁X Dž,DžH1DžC t3Ӌ69ڋC u͋X{0űs4uŃH!J$; R(;udSS&^A N|@ɉD7@|D 9CuK;NusLU=C9v+DžHVVVXDž,C8t;s$TqC$C(l0uTDufFt6 { uC( C$@|D$XT$ $DžHH,x$ $D$ ~ $$}%$$T"D$}$뱃fC$;BBFlBt9@w;s89TT҉ frH9 u@u胅T1DžDS(;NA?TTD$8$D<Dž|$41|dt 9@$9Y:t;$D$D$t#$y\$${zE1L2 DžHB$A@L01򮉕$щ΃D6P$ $\ 11Dž<9@\<t$D$4$v}$\$D$ $D$:y$tHtX}D$0L$$"D$ \L$D$+z$\$ $!$=DplAdD;A K 8hC\ɉgLDlFAiGAhF*Al"$$;MD$y$W$6$蜎D$D$ $Bw\$$y/B$DžHLD$ D$$$x|$uL|1>11Dž<LDžP(lj'DžP\ ;s>Pu7\t..tƋ\\DžP먋($B(=Dž|D$D$L!$u$;xCC^$$HOD$w4$Q_yd ɁL$ t$A@$$"LD$w$klDD$FhD$ AD$Fi$"D$v$'|1$ \ 1\P Dž<у0D$D$ D$t$$r $p$US$4u =v []Ít&41t~9w؋Ěu0D$D$G$s$,v1[]D$D$*$Ls$uk'UWVS] EeU1҅ۉ`t$g;l`t$$u`B<;l$` t4$|$]Í}4$|$]Ív'U(D$ ]Éu}@D$D$x$ k!Ѓt~C D$xD$($b(`$\`[D$D$&$d|$ t$\$$f]u}]Ð_$`[D$D$%$ct$\$$e뫐c1UWVS<]u CD$,D$4$D$ &`  8&D$,1D$4$_D;D$D$4$D$ _u׋C,D$C)D$C(4$D$,D$D$ _<[^_]à tZu14$D$,D$Z_<[^_]Í=4$D$ D$-D$%_<[^_]ÐD$,1D$4$_DD$D$4$D$ ^ u؉u E <[^_]gfC4$D$,D$D$ ^<[^_]ÐC $yD$(C D$$CD$ CD$CD$CD$C,D$C44$D$<&D$D$ 8^<[^_]Ít&C1D$,D$4$D$ ^&DD$D$4$D$ ]uvD$-1D$4$]D;D$D$4$D$ ]u׋C(D$C,4$D$ -D$D$ d]<[^_]Ð&Ulu Í&h$ulÍt&'UWVS,5X}] 1EE&t!Pt9x@t{Eu߅IA yQ SPSPS P SPSPSPSPS P S$P$1I\`,[^_]Ðt&E_&QEEv\=EDMEVUUUE)u}1ɋ}܉] f6FƒuFu҉}܋U܋}]\vUP EUu!(։tUP`P CMACAC A CACACACAC A C$A$,1[^_]ËUEEgfffE)‰UuEl1҅tH] v6t3F<u@Sf-\muljڋ] bJB z J KHKHK H KHKHKHKHK H K$H$1J\`}܋E܋}]\ID$ //D$D$0-$B-*\$4ݷHP x H KJKJK J KJKJKJKJK J K$J$HX`\X1hD$$uFl5XIzh$UU؅lt$x&_D$ //D$D$0-$B-[D$/D$$0-t_t&UWVS]eE1=xsfU1  Er KvKCMHM‹HMƋH Mʋ@EC(EC)EC0EԋC,M։M׉M؈Eٍ4$T$u ; =}e3=[^_]à tRtD$.D$@$0-R^f=uۋCMMMEn1LLLLLLLL u.kvvKCMHM‹HMƋH Mʋ@EC,EҋC(MӉMԉMՈEC-EC.E&fEgpEgCECECECECEċCMȉMɉMʈEˋC M̉M͉MΈEϋC,M؉MىMڈEۋC4MMMECMME1MLLLLLLLL uS1<84ÍL$<984:D$ LD$Ӊ0@$ 0D)ƍNP98AL0D$$EPETEXE\E`EdEhElEpEtExE|EEELD$ 0L $'!lYJƉ$M$&D$MY+8L<<$P7$$&D$YD$0׺$&D$X01҃ Nxduډ$Lt&xD$t$$PM8tԍdD$D$$}e3=[^_]ÍvLËf ]$ MdD$D$ݭ$Pt$\$$T[-I$iD$ D$D$áx$V!ЃN 1fx}D$(|$$`O(}u9EkM  M M ȉE:BBBB@@@ @WzKvdD$$Lxt1D$D$x-$YO$Q=xLJ8$(Rt$$-XQxD$ D$D$$wU!Ѓ 1ۃ$t&(u5}t=ED$xD$($MuHJ8t$ )BRft 9t$1f9}ǃ9uUGWUPUPUP UGPot&xD$D$$/QH&Dž1ҋ ,$։v9${t苽1Dž, <{}ƋK MʋSU΋CEҋ{DHLP}֋@CT,$,/P $)|$ O $袥qt&d$;hdD$D$\-$L\$$@PkD$ $u FOdD$D$-D$ /D$FD$0-$P-KG$H$(D$Od$-D$Od$x)D$Od$L)D${OjG$G$-D$dD$SOvUWVSlE eU1ҋ]=x}EUXt@t;Xt}uD$xD$ D$$Q!ЃF$GD$D$-$J\$$LEEv MUYA2tA9t=t$ |$\$$)LE!Ue3Ezl[^_]ÍvP UP^w\vr= vulu1ɐT\ \ \ ډT uEwt& ~&~&>d\$ t$$4*D$KE!#u56E8Jz uMNJNJNJNJNr OE w wz HrO w wz H rO w w H,r"R"N V V хۉH4}-dD$D$-.$HU\$T$$JE!uM^ZYZYZ Y RQPHV,XQ YI  ʉV(PV-@F.EvXJu ZR  щNu1ɍT\ \ \ ډTu B JR ЋUBEuM^ZYZYZ Y RQPHV(PV)PV0@Q A A ‰V,Er5dD$D$*$F\$t$$HE!4U5dD$D$.$Ft$$HUE!xUT$UD$($EUE(tNA$OBD$D$)$F\$t$$ HEspI(t&UWVS}eE1D$|$$.d]؅UxD$ D$D$$L!уD$(D$ $T$GBƉdt׉TD$xuD$ D$$K!ЃxtD$(T$$B(@$@D$D$&$D\$ |$t$$F$tdD$D$*$TDt$\$$HtD$t$$E<$E0u<]4$Ue3ļ[^_]Ív$`§dD$D$*$C\$t$$E`딍t&$`rdD$D$`*?$m?D$D$%$/C\$t$$+E$dD$D$*pF$dD$D$8(k>$>$`(D$xFD$ .D$D$0-$I-At&UXeE1E]uD$D$$uUe3Eu ]u]E$$dD$D$8($Bt$\$$EUXeE1E]uD$D$$>uUe3Eu ]u]E$蓥dD$D$8($sAt$\$$/E UXeE1x]utUe3um]u]ÐED$D$$}uHE;t 1x뵍t&E;uE;uE;5D$詤dD$D$8($@t$\$$EDt&UVSPu]eE1D$\$$u49ut&u܉$Ku\Ue3u P[^]f1C$dD$D$8($?t$\$$C$ãdD$D$*‰'UWSPeE1]D$\$$u0T$EءEѡEҡEӡEUUe3uP[_]fBt&'UVS=x`tY l1t]Xu )t"C<ut[^]Ðt&`t t@1[^]Í&hD$$uDlvvh$ul|Sv0$x&A UWSPeE1]EXSEءEѡEҡEӡv;E$EEuUe3u P[_]ÐEčv@t&'UWVSlTeE1];/D$/$^:$D$2ED$$=8Ƌtb$9D$D$J.$$茕!Ue3gl[^_]Í&E D$/$!;D$$d</d$d$?*=$<$ =$ 8D$D$ƭt&d$賔1d$K =TZt&$Ȗ\$D$$C`D$D$$sC=dD$D$a.ˉ$ D$D$8+$9t$\$$=$5dD$D$ݭ$D$D$+TD$ /D$D$0-$k8&UW1VSlE] eU1҉E[ƋE 898D$ \$M։U4$UM)t~D$\$4$j u3u$`+:!ЋUe3l[^_]Éщƒ tjE\$U$Uuč뷐$Em$.D$m:U떉$EM$.D$M:Us1} DtD$|$$E|$U$UtEECECEC ECECEĉCEȉCẺC EЉC$EԉC(E؉C,E܉C0EC4t&CD$ \$$u*1:$EK$+D$K9Uq$E($+D$(9UN:t&'UVS0u eE1E܉D$E]\$$!7E܃wUv9uEt$$3Ue3u0[^]:t&'U]]ut}eE1D$t$$uPt twUD$T$$E؉]Džt]؉E4$t Ue3]u}]ÐE$ѐU,$(L>98D$ 鍅< D$Ӊ4$ uu)ȃ@0ty9,t|D$\hD$Cp$`]dOG\9tp^lh$褅(11:P@priv@ate-@ key(@3:rs@a(1:f@ntTD$ JD$7D${D$$0T{D$$*‹t$TD$dD$,pTtD$ @1D${TD$7D$$0T{D$$)t$‹p$TD$z,lTpD$ I1D${TD$7D$$0T{D$$)‹l$TD$\D$+hTlD$ R1D${TD$7D$$/T{D$$(‹h$TD$`D$~+Th))(1U@0:cr@eate@ d-at@XT$D$ D$D$2D$.T$++D$ [1D$7D$D${$.{D$X$'TT$$'f))@)D$ E |$D$$0 1-<$d$賁4$諁\$蝁`$菁؋Ue3u [^_],D$ FD$!D$1$.1'D$ FD$ D$1$8]''USÃuru=ft,D$D$u1$($;D$^[]Ít&D$D$m1$'$;D$|^fD$D$e1$'$;D$L^]&D$D$`1$h'$;D$^ UWVS,}MM 119u i9t`9|t&D$D$9$&$ ),[^_]D$D$1$&UT$$(,[^_]È7M 11,[^_]D$D$1}D$D$1hD$YHD$$1)'UWVSÃ\ D$$r@x<$/ED$( D$$D$,E t$D$D$D$ ED$D$ D$|$$?u8$ԀUP$w$D$q\[^_]f$0$lD$0'\[^_]ÍD$D$1$U$$9'UD$GD$$1U(t&U8$]Éu}<$K& @OU$FUPF|$FL$&4$v$D$p]u}]ÍU1ɉ(Ext EuXMuGMuUuÍt&ʃ ҈UtUD$ T$D$$%Ív M뵃Mf뢍&'UWVS,D$D$,9$}#$1Z$}1ɉR&D$D$8$@#D$D$$"#t$$Y8uSD$L$D$\$ D$D$$^pt ,[^_]É$}{$1s{D$D$`9${"$/Y1뼍t&'UWVSӃD$D$d:$}|$$-V@M܅EtOevvUԅҍvEtTekv}ЅvEtDeKvMt&;v$t&wE<[^_]ÃM&M&UWVSӃ<D$D$:$$EUD$D$V2$eD$$UD$D$o2$9D$$TD$D$(;$ D$$TD$D$2$D$$T EӉ}ԍD$D$UX$$2D$h}?<$EȈU0vŰEȄt}t<[^_]Ít&6v:Uԅƒt&u D$D$X$$lS&D$ D$<$<t&}d<[^_]Ít<[^_]Ít&h<[^_]Ë=J}԰fD$D$H;$D$$RD$D$t;$D$$hRvD$D$;$D$$4RD$D$=2$\D$$RD$D$V2$0D$$QD$D$o2$D$$Qv]7<[^_]<[^_]Ë}԰Tt&UWVS,EU܋}܃ҁUt}7}E$;D$D$;$!t$ U\$T$$Pu܅D$D$;$D$$7$2ljD$誈Sy><$Ezr4$rrE9wc;Er^D$D$2$l\$$P1}ڃt,[^_]Í&E$D$D$%xfED$ ẺD$t$$\$|r$rƋEFC Ut EFCFCẺ$FpEЉ$tFtẺC`EЉCdEԉChU؉SlU܉SpUC1C4St$-fCxCl$UUCpfSx$UU‹CtfSx$UU‹EfSxt\$$UM t;U C4C8GCnƋEFC Mt EFCFCẺ$ FpEЉ$ FtEԉ$ FxE؉$ F|ẺC`EЉCdEԉChE؉ClEC1C4Cp$mUfCxt\$$UE t;U C4C8GC$*$=<$_D$D$93$$E3D$ulj$7uf5|hts<ftfu/&C$a@-f4D$D$?$P$=nt&D$D$Q3$$<UD$@$(:t&1}؉t&!D$D$>$\$$i<t& (INCSECUCRE!)C Cvf Xvf (C$D$f)Xv}؉<$1^4$]U$]3E܋}؉$]EыU}؉$]ED$D$>$$y;]ܐ$]D$D$$$3D$lsÉ$B5 dt"<(t&<)t" f<(t<)ftu]ftD$D$3$$:[]@ |u|$upD$D$3$$:$\D$D$l3$$|3D$rÉ$X4#c;z]}؉<$G\E܉$<\U$1\E$&\4$\1,[^_]Ë}؉<$ \E܉$[U$[4$[}tƋE$),U$[D$D$=$$9D$GD$$13vU(]1ۉu}t/$+Ǎ@P$]xÍ@Lt$$؋u]}]ÐUu Tt&tJ;PuP 0 w) D$ D$$P!à $uvÉ'USÃ$+]$T$cM[]Í'UVSÃuV6tJF uF$D$荝t$QeD$F$D$H[^]Ít&1[^] UWVS<} M6D$D$@$$71ۍv$Y8D$D$3$$4D$|o%`$M1U\$$D$D$L4$;$6_u4D$D$4$$4D$m*$X<[^_]Ãt#D$8HD$$1O&UD$D$@$$I6t&D$D$4$h$ËE$D$#ZD$D$4$)UD$D$4$T$D$ ft$$04m4$W;UE$ZCt&D$D$B$p&EE$ ulD$D$h4$EqU$T$5Ex_U9UD$D$=4$3$4ZfD$D${4$EU뒍t&D$D$$B$D$8HD$$1KD$8HD$$1/ UWVSL]$D$,D$(D$$ED$D$D$D$ E\$ D$D$E D$E$e}EƋEE|$4$#<$IF0@PH҃ @T$ D$D$ E$4$赊L[^_]Ív$p`$BD$pL[^_]Í1 q$`$BD$L[^_]Í҃=t&PH H H Px ׺  z_t&1fD$LHD$[$1D$LHD$R$1&UWVSӃ\5EЋ} Mԅ.D$$Gn@p4$Ht1ftP:uZuME܉}܉]D$,D$(` D$$ED$D$D$D$ Eԉ\$ D$t$D$E$u>$UUP$LD$EЉ$E\1[^_]Ðt&ED$E\$t$D$ E$_t\[^_]ÍvD$D$B$$ &$E]$lD$Ũ\[^_]D$FD$$1D$FD$$1UWVS\E EED$$&F@@$D$q;9)ǃD$D$$|$$E1($\D$D$4$t$$E<$EQEЉ$:QE܉$/Qt$Et$Ե$訝Eԃ\[^_]Ðt&{ {1t{8 $»D$1D$$${.E1ҸMERE1D$D$4$EeEVEȅEtq$P ɉ+PE܉<$蝜ED$D$D$D$ D$$D$EЋEMUD$D$ED$ E܉t$D$EЉD$E $EEًUt$D$E$MEًUt$D$E$E 'D$$:+YE&D$1D$B$$REE&D$D$$${,D$$諿3E1t&$11EEt&D$D$$Py&떐D$1D$$$+ERD$1D$$$+ED$D$4$$4D$LbEE EfvEEjD$ FD$e D$1$s8t&UWVS4$螽tD$94$芽$1UWVS<=puD$ D$tD$ 4$M{(D$ D$D$4$${܏2D$F,$yD$F0$y}|$D$EԋF,$OEz]ԅUЉ$CUЉT$ËE$D$MԅX#U"1;t <u 9Аt&r9T$ \$D$4$.z$@1=|$D$EԋF,$fE[Uԅ?x|$SB|$ËE$D$}ԅC Uu1;tt&<t&u9r9OT$ \$D$4$gy$?4$D$_<1[^_]Ðt&E$=BMԅɉ D$F,$wD$F0$w܏D$ D$D$4$xt&D$ F,$]wD$ F0$JwHt&E$A}ԅ#D$$&D$F,$vD$F,$vi&v?t&ft&'Uuu ]]V 3t$$Gt$$$D$]1u] UWVS,$P{@áp%܏$?=1҅C< fC<PtCD$|$E=MËE؉AC E@CE܋UMBpUQt$HUC`Bt$7Cd$0=D$ $D$C1C8Ch ?u tzCLO w tkVtc118t&9;0 LMG<LjCLw7t-Vt%9~p9~ŀF7뺍&MɍvtMD$$<UuvMH$Z3D$E$,D$$w<X$%3D$E$v,Ue3Eug|[^_]Í&UP$2M $D$5,D$$<f1qsvWv$ D$?5D$ ev$Z5 E܉$E$E4v'UWVSLE]m$a$$D$J;@ƍ@ \$$E D$$o,w@@$D$A;9E)ǃbD$D$$|$1$X (uq$BD$D$4$EUȉT$$E<$7t$H$5EԃL[^_]f{ .$FM$1ED$D$$,}EEt1}E=t <$v{E1ҋMt$D$ ED$ED$E $EEًUD$EЉD$E$wEًUD$EЉD$E$E N}D$$:R@ED$1D$B$6$zEb$D$$t`1$11Et&D$D$$&1t&Cǐ4vD$D$4$p$x5D$JE>D$ FD$ D$1$y8t&UWVSÁeE1BlEEEEzJB$iV 1Ft#T$ D$D$$'bF $\4FFF $gt[F$f^D$D$ƭ$%|$\$$!t&F $mgFtt$FVT$D$_$>a$h1džt&T$ D$D$$a$H3dž$?JNj$6 dž<$ V*h=&EE"l҉EM\$D$D$ ED$E$ftld]t)S؍vxuDžtV $w$iD$4$ppD$$F E4$D$LEpD$$- 4$;p $-1҉DžpED$$%@p~<|$4$<$<4$G4$D$@ D$D$D$$v$=bjED$ D$D$$跘=& 1҉0tp t%{Pvxt&;uD$D$$E$$  vD$D$5$|$$*EE.EU11ۉh`tL{3fxt&"u1Ƀ{ut&xfu1EUDd؉p1҉t`D|$D$T$hL$dT$UT$ t $p辽htR{ ؍t&x t&u{ uG& >?fu1ldd#{t&xt&ut&`\p}D$$pB,D$B(<$D$ '6D$2D$D$T|$D$ $$?hNjh$v-Ɖ<$]$nD$D$ D$0ht$L$$&h$,p$蚑t $茑t&<$7$?5D$ufۍt&tv{u{ K tg11E$%E$%lEu t$Et$Me3 g[^_]Ðt&1땍t&<$(7D$D$4$t$$ 6$C<fE@@ED$ GD$K D$1$5~ D$D$5$|$$lgD$D$C$Q|$$EiEaE|t&džD$D$_$^X$5D$D$XD‰@$@T$$4$p$uM1҉\$D$D$ ED$E$XfUEMD$T$U$:EMUD$D$E$E؍U tEMT$t$躪dEMUD$t$E蒪 t&l*uxt&ut&ؐH ؍x ߍ E aEWU؉drMUp hNjEɉty tD$ $ @@D$`t$ @@P $D֝dDpD$(0 L$ `D$,D$ED$$D$D$D$T$D$ L$$$i*UP$U!D$h$$7*E@$D$Ǝ@B$!t$D$S؍&x mM1҉\$D$D$ ED$E$.Ǎt&8؋}M|$‹ET$U$؋}KMU|$D$E$EDžt$Zn&FUU ED$$@ۋ@Pu,1ɃtBJt&tڃ{u{ K uɃ TTU}Dž|$PHELS$`і9`ps  D$ 'HD$ D$1$ 6zSEpl x_uDž\T xGfuDž`U؋}DtFhDUT$ \<$D$L$pT$hL$`L$tiJ$j/$lD$j4$D$D$5$3|$$sdNp$D$D$C$|$$.><$.4$@CD$D$DD$@DT$L$$|Ӧ$|h%8t@ @tD$ D$$`D$t`\XQx|`Ɖf$t9pfZxw܋\XT$$訆hɉptVhtB4|tQ8PQ{ t^ t&x tRu1D$$Z{t?t:?u{ ukf~ t&tf6uQؐx t 뫉ߍv tƃ D$ D$D$<$F_$=8닉ސt&~ E΀D$ D$<$mEtF <:tDfu4<:ft8FU$FD$T$莿yt&<:u1҃]Ӎt&?<$觐tDЃu]袪D$D$$ $8x@7G $8X@ƉP 81ͫJ$k$$@ Ǎ@ T$$ҷۉ718$l[^_]Ít&U1M{U؅҉($8@Ǎ@ t$D$ 0D$D$$VE1҉2$80ƸFF T$D$ =WD$D$$>?׉󫉕utU:uEHE$I$("$D$ D$D$$:EEDžDžE؉D$ UԍE܉T$D$$)]؃Ru܉‹8t&DG u<#<%FD$:4$t98t:DG u;$讴$D$ GX G1t&4 G.\$4$چuޅ4$Gt+C;pu;pvu$$$ NjwGG \$$btt&DG t>t:t&DG u4$菳4$D$oD$57$t$$t&苝7D$ D$U$7T$l$i?l[^_]Ë$Ut) vt2xux H t#11 oDžr1D$;7$܄Dž1۸\FD$D$7$c$gP $`D$D$ݭ$"\$UT$$ $8j @Ǎ@ t$D$ 0D$D$$.1҉$8 @ƍ@ T$D$ =WD$D$$״>$8 0@@ sign@$8 @ƋED$ 0D$D$D$F $t>$8r @ encr@ypt0@E;$89 ƸE $$ @>F $$ U0@P ${<h$m<t D$ D$D$$4`t D$ D$D$$4$$`$d$^p8X+$Uz xu111YD$D7$>$Ut8t$z2 x*u111ӝ161%$:2z7D$L7$n+tt$$Բ$4$2DžG$=K3@EuuDž7u DžuDž7u DžuL$D$D$ SD$D$D$B $贰:bD$U$7T$07D$U7$+u`tt$$蕱Id$4$Dždx H c\x H t$\$$^7贬7U8]ÍEu։}ω$}wCMS$D$L$蕫ETTDuP}S]]D$JD$G$fHKt&'UWVS,U Mu}t1),[^_]Ð+V +1ۉE9]1҉uމӋGuUW(;W,sMG0G WW(tlP҃FuD$$tIFkt&<$uu)$HتF0@OMQD$$Bu^U1ۈ29u.u䐍t&1$IMH,[^_]Í&E@&1롍t&E1U1ۋBB $FMAd&u>zN wEBsÅ3FV tMSSQU,[^_]fup~BEBM1DDDbDD F 뀍&M a$Iܨ;t&E8U1!t&u>tBF}߉-UCMSQutEDF RM1ۋA$DE@pvt&E10@L&=@4DFF$t&U:M1MQ$PIyF$H\F$H?F$,I"Fx$HFY${HF:D$JD$c$fH7&U1WVhSׁuEEEEE$H:t$D$ É$*v$8 \$$ =$9 M܅tсĜ[^_]ÐUWVS}/`1uY`tJ|$$but6`8t*D$D$$膣$WwD$2(D$D$J$X|$$E=b[^_]D$D$J$$ǐUS]$C$C$C $C$C$C$C$][]rfU4$Ɖ|$(at+.at 4$|$]ømd4$|$]øU4$|$]Ð&UVSuuBFStT$$"vtgVto&[$toCD$F$uuF tS tT$$utFtStT$$uu[^]ÍCt[$uߍUWVSÃ,$~*J t t t uBD$:$.t\$$ u;1ۅD$:4$t4$D$_q5F<7D$:<$蓝ED$ D$<$F4uD$:E$Ix5D$ D$E$蚟F,D$:<$tD$ D$<$[OD$ D$<$U2UB$8D$:4$蔜tD$ D$4$4$D$ D$UǞUB(p(p9D$:<$tvD<.$|eL$4$D$ܿljƉPу9vD1ۉt$@8$5"4$=D$3a@8$"@<t&,[^_]Í$@ǣG8DJ0,J0 J0t&\$$ru1ۃ,[^_]ÐjB,[^_]Ít&؃,[^_]$@ƣXF8@$H09lD$:4$MtJ\>:€%BuzBtـztӉ$U&pUtuL>B빐@(D$ D$<$;F4GD$ 5D$E$F,$1,?f낍&'UWVSUUEMEiUNjBgơ x<$蔝4$芝D$|$É$$hf/$ZE$Ogpgk@eys_@t$$MA tU.D$$i \$ߜ$D$<$Ɯ -o @"%O"@ "%If@ "ED$D$D$ \$D$$DE$]taM $D$D$h$菚\$$菜EĜ[^_]Ð4$$=D$ }D$fD$Eԋ@ $D$ D$6aD$Eԋ@ $軖D$ }D$BaD$Eԋ@ $蕖UBD$NaD$D$ Eԋ@ $mMAD$ D$YaD$Eԋ@ $=Et6t&D$ D$aD$Eԋ@ $EEuϋUBEt3fD$ D$aD$Eԋ@ $ǕEEuσ}}vZ}D$bD$Eԋ@ $p]E1R4$L<$EAU4$DD$$$f |$4$Z{|$ D$D$Eԋ@ $9]u<$֙$D$D$lf$$E.EĜ[^_]É$胙$D$$j -o @"%o"@ "%if@ "};gpgk@eys_@curl@ .ED$D$D$ D$\$$@Eo$ޘ_uri@} D$D$c$$躚}Gt"D$ D$daD$Eԋ@ $rUB t"D$ D$maD$Eԋ@ $FMAt"D$ D$vaD$Eԋ@ $}GD$ D$aD$bD$Eԋ@ $ݒUt5]&CD$ D$D$Eԋ@ $角uD$=bD$Eԋ@ $胒}_ S wD$D$f$覕\$t$$EEԉ$:EEuEt&E܍UEt$ D$T$Eԋ@$ +]؉$ږǍ ~+t&Qǀ t t t u ܉;;D$D$)c$]iu1D$ D$$b E9D$D$2c$iuTD$D$}$hD$D$g$A\$$聖t&D$D$;c$hEue ]ub}t\t& }fáD$ED$ E \$D$Eԋ@$$`$(E؉$]U$REԉ$6 EvD$D$c$*$.E7EĜ[^_]à t?uMYD$D$ h$\$$E7FD$D$c끋UBD$D$h$莒D$\$$膔E7}G}wt}ct}3tAD$D$Hh$&t$\$$"E7EruD$=bD$Eԋ@ $荎EX $ pD$D$@g$谑\$ t$U$T$D$/bD$Eԋ@ $&E!&[UENjE$D$ T@@8 |$$T$/MЉL$D$ E<$D$<$%EЉ$ xEЋ@@PHT$@DD$?bD$D$ Eԋ@ $[]1}t&OۍvStvރ fu׋rD$4$ ~}E4$hNDV~HMKUYb9tVbML$$MD$L$ E|$D$}T$ D$\bD$|$Eԋ@ $背~(SN$%D$=bD$Eԋ@ $O}EЋ@@PHT$@DD$bD$D$ Eԋ@ $ EЋ@@PHT$@DD$bD$D$ Eԋ@ $؋Eԋ@ D$D$ G,D$G0$EЋ@@PHT$@DD$bD$D$ Eԋ@ $<$UZ zEЋz@@D$^D$D$ g$脎\$ |$t$$輐EЉ$E$6}?}EfBPуHL$H T$L$PT$@D$xbD$D$ Eԋ@ $虊YzWKD$D$Eԋ@ $hGL$٫E$RD$D$E$ǮE$謶E$%tt]11}]9<tHD$ D$ &D$Eԃ@ $ۉ9s$<%t <:t<vD$ D$G뽋]}U$M $E$G8D$G@D$JD$D$ Eԋ@ $^G04D$qD$Eԋ@ $*D$D$Eԋ@ $<$vEЋM@1@D$D$D$b$t$\$$DD$aD$Eԋ@ $腈M]1}At& rv $9 uD$aD$Eԋ@ $ 1҉}މӍvD D$D$D$ Eԋ@ $҇uщ}D$=bD$Eԋ@ $訇MQ I$UMŀED$D$f$躊UT$ ML$U$T$ D$aD$Eԋ@ $*1҉}މӍvD D$D$D$ Eԋ@ $uCD$C D$aD$D$ Eԋ@ $輆CD$aD$D$ Eԋ@ $蒆D$aD$Eԋ@ $o-D$=bD$Eԋ@ $LED$D$g$t$xM$UCD$D$a$E8UT$M$L$n$D$ D$赈D$D$hg$\$D$$ߊBD$D$Eԋ@ $`MD$D$b$芈\$}|$$ÊED$D$b$Q\$$葊E}Eԃ}EE@E}1D$уL$M $$EkE$$1EEEEEEčU}E|$ D$T$M $ ,ɉ}u#D$E$LcD$[D$E$LcD$[u0UD$$[cэD D$[QED$Ww$D$D$E$`cD$O[ut~D$:4$Ӄt}|$D$04$-Et7D$:$范tẺD$D$0$~sېt&#1`E;EAk}$ }=,US<9v+1Ƀ}tM̋}<$UEEED$C8$DC8$C8@0D$ ED$fc$D$xC,~D$D$pc$YC43lw[%D$HfD$$a臈EES<UC8$$  t&uD$c1$輁D3 D$$D$蜁uۃ{$q{(t& C0t4D$D$L$+D$w$D$3D$=b$$OYD$D$;$D$D$p$讃D$w$D$趀C0CD$D$i$rD$w$D$zC0D$,$^C($oD$D$5 $t$$D$!D$,$C$$D$D$L$迂t$$D$9D$c1$D3 D$$D$u$EtUD$$TcэD D$VEa Ek$D$U$EE ̙aSvuT$ D$D$c$~?C $gvD$c$D$~D$xc$~HD$8fD$$a}uD$D$hg$"t$D$$}u5}D$D$g$ML$$}<$E$E$!}u=Et&뒋Ẽt|Lk$ED$E$EU;Ut,1ɋ}<$UEk1Ʌt6E h밃}uD$D$c$$T0 UWVSlEU D$@DžEDžeU1҉$B~|$($UC$)C D$cD$ D$T$D$4$资D$4$_U'1Džt& ‹ !%tꩀu+||$C $ C T$$f|0tg|$C $qC D0D$cD$ D$D$D$$赃T$C $萂D$<C $w9$}$bDD$C $C Ɖ$BkeysfF.D$C $$T$S1ɋ\$ $T$D$Ƌ$$ Ue3u l[^_]pUWVS<ɉEt =D$D$h$|$dD$e<$fJ;9}uЋF81]D$ddF$WJD$qdD$ PD$ddED$E$UNF$$mdFD$qd$ǡu<;/t&$FL[^_]Ð<[{/t&@/~1;<@<@[t&:F>/51;<:tuG$F |$\$$[rF ;8<:R$FxN L[^_]Í&<$iu://\$$/x\yщډuԀ]Bztm$;u{t1҉ٸ|$ D$D$$Et$$MEbED$D$h$lUT$ ML$Ủ$T$nY&}Ћuԅ~w1t@}D$D$d$^l\$UЉT$$nD$ 1D$D$Eȉ$MĸƋUĉ$E,\[^_]ËD$D$d$k\$$nw$$EE B&UES$EHxfE$;tG;tD$g$?xdD$D$d$?uI 먋Et+D$ D$$l$xu $x@$[]ÍvD$D$d$X?u4% @D$d$>[dQD$ D$@xD$ $>D$D$$жD$D$$ &U WS@UeE1]ЉEE܋B1D$D$$EE D$ Ue3u@[_]m&U XeE1U]]}߉uu} unE E T$D$ D$Ẻ$g1Ҹt$ D$D$$Ue3u(]u}]Í&} uE [l&U8$]uu }UD$E$ øtrD$ D$D$$ t?D$D$$<$EF$Eu]u}]f$E$E҉'UWVSLEu }$D$@$ft.ED$ED$$x|$t$ $D$t E$iEԃL[^_]ÍtڋEtcD$ D$D$$Et%D$UЉD$$UЉ$EE$xtoD$$D$]Eϡ@|$ t$D$EUD$@$UЉ@EԋE$t&D$D$lf$xf$hEGU WVSleE1]ЃEE}1ۉUEut&4${D$ D$D$<${tmD$ 1ҸMD$D$${t$D$D$(i$EeU|$T$$gXD$D$Pi$Pe|$$g8Uu1Ue3ul[^_]hU U|$} $t$BvAr^ 9r+tt ~t4BU)ȅt&1$t$|$]Í&FBǍ'U}U tҸotAtj]fҸjtjtj]Í&'UWVSl]uE} EEEEE]ĉEȉt$$t$$E'ۉEE؉D$$mf]1 9n;uEỦD$T$$otӋCUEU`8UĉT$$wE4$U$޷E$U$ȷEUe3EX\[^_]Ðt&Z$ZD$D$m$^\$t$$`4$[$'Z띍$x4$ vJt&lF\IR FHEԋUĉD$ED$|$T$ $D$IU$eED$G$kd=tBE4$y<$qD$$e`UED$ T$D$B D$B$(D$D$m$0]$kD$,YU$ <$ص4$еeUWVS,]C3t$C t$]C~JD$\$$^t t)D$D$m$o\$s^C<tPC$-C$"C$C $ C$$$,[^_]Í&C t$]C$t $]tdC$_pW$W{D$D$n$E[U|$T$$]'&7W$W{$D$D$m$EK[U|$D$؆T$ $|]K&V$5W{ D$D$m$EZU|$D$oT$ $$] UVS]C $[CC t;up\$$D$ T~OƋ$OD$D$\o$S|$\$$U>$Qv}cwEdUT$G$UȉMcMċUȉGt&1E# 1t&x|x|JxJ| u0[^]Í&UWVSuM8Zr B B B rR  Љ111ډ1Á11Ӊ1ځ333311‰1%111ځ⪪111lj?3@w?3@x?3@y3Q?փ?3@z3@{yx?3@|??3@}3@~Q1ډփ?3@w?3@x??3@y3@z3Q փ?3@{?3@|?3@}?q3@~1Ɖ?3@wډ?3@x?3@y3Y?3@zރ?3@{?3@|??3@}3@~Y1Ӊރ?3@w?3@x??3@y3@z3Yރ?3@{?3@|??3@}3@~Y 1Éރ?3@w?3@x??3@y3@z3Y$ރ?3@{?3@|?3@}?q(3@~1։?3@wÉ?3@x?3@y3A,?3@zƃ?3@{?3@|??3@}3@~A01؉ƃ?3@w?3@x??3@y3@z3A4ƃ?3@{?3@|??3@}3@~A81Љƃ?3@w?3@x??3@y3@z3A<ƃ?3@{?3@|??3@}3@~A@1؉ƃ?3@w?3@x??3@y3@z3ADƃ?3@{?3@|?3@}?3@~AH1Љƃ?3@w?3@x??3@y3@z3ALƃ?3@{?3@|??3@}3@~AP1؉ƃ?3@w?3@x??3@y3@z3ATƃ?3@{?3@|??3@}3@~AX1Љƃ?3@w?3@x??3@y3@z3A\ƃ?3@{?3@|??3@}3@~A`1؉ƃ?3@w?3@x??3@y3@z3Adƃ?3@{?3@|?3@}?3@~Ah1Љƃ?3@w?3@x??3@y3@z3Alƃ?3@{?3@|??3@}3@~Ap1؉ƃ?3@w?3@x??3@y3@z3Atƃ?3@{?3@|??3@}3@~q|11Ɖu싱31։uEE??E@wu3@wu1؉?3@x?3@y]?3@z??3@{]?3@x]?3@y]3@z?3@{]?3@|]?3@}]?3@~]?3@|]?3@}]?3@~1Éރ?3@w։?34@x?34@y3?34@zӃ?34@{?34@|??34@}34@~1Ӄ?3@w?3@x??3@y3@z3Ӄ?3@{?3@|??3@}3@~1‰Ӄ?34@w?34@x??34@y34@z3Ӄ?34@{?34@|?34@}?34@~1ڃ?3@w‰?3@x?3@y3?3@zÃ?3@{?3@|??3@}3@~1ЉÃ?34@w?34@x??34@y34@z3Ã?34@{?34@|??34@}34@~1Ã?3@w?3@x??3@y3@z3Ã?3@{?3@|??3@}3@~1ЉÃ?34@w?34@x??34@y34@z3Ã?34@{?34@|??34@}34@~1Ã?3@w?3@x??3@y3@z3Ã?3@{?3@|??3@}3@~1ЉÃ?34@w?34@x??34@y34@z3Ã?34@{?34@|??34@}34@~1Ã?3@w?3@x??3@y3@z3Ã?3@{?3@|??3@}3@~1Љǃ?34@w?34@x?34@y?34@z{3?34@{?34@|??34@}34@~C1?3@w?3@x??3@y3@z3C?3@{?3@|??3@}3@~C 1Љ?34@w?3 @x??3 @y3 @z3Cƃ?3 @{?3 @|??3 @}3 @~C1ȉƃ?3@w?3@x??3@y3@z3Cƃ?3@{?3@|??3@}3@~s 11Ɖus$3C(1։uEE??E@wu3@wu1ȉ?3@x?3@yM?3@z??3@{M?3@xM?3@yM3@z?3@{M?3@|M?3@}M?3@~M?3@|M?3@}M?3@~K,1΃?3@w?3@x??3@y3@z3K0΃?3@{?3@|??3@}3@~K41щ΃?3@w?3@x??3@y3@z3K8΃?3@{?3@|??3@}3@~K<1΃?3@w?3@x?3@y?3@z3K@΃?3@{?3@|??3@}3@~KD1щ΃?3@w?3@x??3@y3@z3KH΃?3@{?3@|??3@}3@~KL1΃?3@w?3@x??3@y3@z3KP΃?3@{?3@|??3@}3@~KT1щ΃?3@w?3@x??3@y3@z3KX΃?3@{?3@|??3@}3@~K\1΃?3@w?3@x?3@y?3@z3K`΃?3@{?3@|??3@}3@~Kd1щ΃?3@w?3@x??3@y3@z3Kh΃?3@{?3@|??3@}3@~Kl1΃?3@w?3@x??3@y3@z3Kp΃?3@{?3@|??3@}3@~Kt1щ΃?3@w?3@x??3@y3@z3Kx΃?3@{?3@|??3@}3@~K|1΃?3@w?3@x??3@y3@z3΃?3@{?3@|??3@}3@~1щ΃?3@w?3@x??3@y3@z3΃?3@{?3@|??3@}3@~1΃?3@w?3@x??3@y3@z3΃?3@{?3@|?3@}?3@~1щ΃?3@w?3@x??3@y3@z3΃?3@{?3@|??3@}3@~1΃?3@w?3@x??3@y3@z3˃?3@{?3@|??3@}3@~ʉ1᪪1ȉ1Ӊ1ف111%33331Í1ʉ1с11ً]1%11ȉ KCCCC1KS[^_]Ðt&&U$M UE v'U$M UEu v'UWVS;yU1EMU1fM9M]u9uM\E]U}U\2]]tU0Ut0Utu0U2u]Ut149UU1ۋu9u|R9~N5}4u4}4}M9]MuE0ҋu9u}}9}U1EE GfUt14u]U0]]0]]0]]0]t14ut&9}St&!u  31~E0 9}эvEE kU(]]ԉu$}eE1D$D$g4$D$\$8t#Ue3o]u}]Í$މ\$\$8u$D$D$4$D$\$&08Q$މ\$\$/X8X$D$ D$,4$D$\$8$މ\$\$(%keUSeU1ҍtMڍ&9uEe3u Ĕ[]fet&'UEUM E EO EJ E J t u $]Ív]Ív1 u0]ÍUEU T$ PT$UT$$(T'UEU T$ PT$UT$$hT'UWVS8eE1EE]E#}EEEgE؉E٫EEEEE޺EߘEvETE2EEE#EEEgEȉEɫEEEEEκEϘEvETE2EEgEgE1E8ETEEiEsEEWEEVEHEE¾ECƅlƅm#ƅnEƅogƅpƅqƅrƅsƅtƅuƅvƅwƅxvƅyTƅz2ƅ{ƅ|ƅ}ƅ~"ƅ3EDEUEfEwEEE4EEEEEENEEEEEE EƅLƅM#ƅNEƅOgƅPƅQƅRƅSƅTƅUƅVƅWƅXvƅYTƅZ2ƅ[ƅ\ƅ]ƅ^"ƅ_3ƅ`DƅaUƅbfƅcwƅdƅeƅfƅgƅhƅiƅjƅkEEE#E}EEEElE E$E|EEE:EuE D$D$Eԉ4D$8$\$<8tUe3h[^_]Í8މ$\$\$ 4`8ulމD$8D$}$Uԍ8T$$\$8Y8މ$\$\$48!LމD$8D$ }$Uԍ8T$$\$v88މ$\$\$4(%Z_U]]uutt ,t ]u]ËXtTtE]2u]ÍXTtD$$`]븍t$E $D$} C1rUE\E ]`Ít&'UU EUUU}t1]Í]ÍvU}E t 1Ðt&E'U8}}]Éu֋$MmP$UQT$ W t$$T$E!T$ED$$T$ ED$M$L$E]u}E]VUS$]}Ut$[]f tjCtct]JtVJtOJ tHEJMJMR U$O$PU U$K$1[]Í$[]Ðt&U8}]M u}t]u}]Í1trQtkYtdI t]UM$O$PMUt$ L$T$lj$c \$<$ <$}UЃ{k&'U\tD$`$ËL$T$\ÍUWVSD$#EE$&D$ ED$ËF $D$F\$$D$o F \$<$D$ ED$UFD$$D$NF\$$D$+ F\$D$ ED$E$E|$$D$k$CtF\$$D$\F\$$D$ FD$F \$$D$E܉\$|$$$I<$IE$I,[^_]É'U8MUttÍvEJMJMJ MJMRU$B$DU MU1É'U8MUvÐt&EJMJMJ MJMRU$5B$CU MU1Í&U8M]U u}wRr :R4$UA$QCUt$T$É$,|$$$VHЃ]u}] UWVS\Uv\[^_]Í&E ] E $pA$B} Eĉ<$<$$ƉD$P~ t$$@t$\$Uĉ$] Eĉ$b9E tt$Gt4$uG듍v$@$AE$@$AU E$@$wAEE $@$aAU E$@$KAE\$D$E$t$D$U$ED$UT$E$ UT$ED$U$ED$UT$E$$ @$KAD$lj$iB]]uuvD$|$<$t$|$$$t؋U ]u$?$@EE|$D$U$E $s?$@Et$\$$x \$$*"t$$"U$T$"E$D$!U$T$!E$D$!|$$!U$T$!E$D$!U$EE$EU$EE$DU$DEċU}̋} ]ԉEȋEUЃ@u؉E܉<$H>$?<$6>$~?Eĉ<$#>$k?ƋEȉEẺE<$D$D$$D$ NjE |$$9D$<$}WEčMUĉt$$EĉUčMqt$$uu$CUĉ$C4$CEȋUẺBEЉBEԉB E؉BE܉BU1$7U\1[^_]$|J$pJUEhE ]lÍt&'UhtD$l$ËL$T$JÍUWVSL$UԉEI<$=NjE$4<$=ËE$<$=EE$ <$=$E>E؋E$dD$EED$EЉ$WEЉ$@Ẻ$E܉D$ẺD$$KEEEċEEȍ&EԃED$<$>E|$$D$ ẺD$ D$$EЉ$D$V~}vX}}=vE\$$D$ E؉D$^ D$$69uv|$$u}EЉ$D$t&+E}ED$D$$ D$ <$ƋEĉt$D$4$Eȉ<$D$teEȉ<$D$EЉ<$D$7yD$<$D$ D$D$*$B&Eȉ<$D$!Eȉ<$D$늋}1<$3@$+@E$ @EЉ$@Ẻ$ @E؉$?L[^_]Ðt&UWVS|EUM.d1҅ $˝EЋE$-9$:$E:}Ek$9EċUĉ$ =Mĉ $E<]ĉ$E<UMEEȋEUMEU]E$\$D$MD$ L$ÉD$Eĉ$$UMĉT$ $}t]Eĉ\$$UD$$ `{t51ۋMĉD$$L$UЉ`{u`{EEEtVEЋMԋE9w)))؉]v]lj֍sUԉMЉ4EE`{u]ȋŰMĉ$T$L$qEE\$$D$UM\$ ]T$L$$yD$$uEȍUzu6E} tE} NtH`{. EԋUMȉT$ $^u2 $B'B:$7E]$<E$<U$<M $<]ĉ$<EЉ$֘Eȃ|[^_]`{ftEU$?8E11CEEt&E\$$D$1MЋ}9<<tP19Uċ}!D$VD$$m1'UuE$D$gD$t$#1vUS$tL$ T$D$${ ӅxW$[]Ët. ut 뽍t&tλ 뮐t&EUMZMUE$H0vU11S1҃][ĕtĕȕt[]ÍUWVS, utr4$肇t>1f1EE }E  fEm]mE9uƋE t$<$D$[<$#,1[^_]ÐD$D$p$ ,$d.D$D$$+$bQA'É$' v'UHD$ XD$4D$D$4D$0D$,D$(D$$D$ D$D$D$D$L$'É'UWVSÃ\5Uąt\1[^_]Í}1r11fEfE|$D$ $/u& tK tF$&D$D$$*\$UĉT$$,\[^_]ÃCuUET$D$ D$D$$,ND$D$$*UĉT$$M,EuED$D$ D$D$$, 뇍'UWVS QC6=1ҡv [ZZZ u4#D$D$A$%@D$D$$,t&D$X$D$s&We$t҉$$5D$D$$r(|$t$$*$*+[^_]#$U$5D$D$$(|$t$$M*$*[^_]D$D$$'$*|t&#$#D$D$ƭ$'t$\$$)07#$#D$D$=X#&UWVSeE1D$$#1$D$\$$+4%=#TP X 9D$Xt$$%uO"tۉ$o"D$D$3$+&t$\$$)&=XW$(D$D$X4$!D$D$$$(D$D$$ 'D$D$$y11ɺt&Ue3[^_]Ðt& $=!5D$D$$$|$t$$5'$'1두 $ D$D$ݭ$$t$\$$&1=t&5D$D$$b$t$$&$'1vD$D$ $($$l&$&1t&0&D$D$$#$&$&1k2'mOfUWVS,E} E~ĕ} :E EMtE$~E܋Euܐt&]XvX=} u'&xEtE uo=1ҡf [ZZZ us\$D$4$#)]7&=k=1ҡt& [ZZZ uf1ҋ=E࡜& =X Ƀ!9uUࣜ)ډX9u)]/E܃,[^_]Ms}  +==97)=X¹R==EE 8=,81^E$yED$|D$b$#} y E } m} vfvU(]uu }}D$ED$$-t$<$ÉD$O!u]}]]xUEE ] Ít&'UU EUUU}t1]Í]ÍvU}E t 1Ðt&E'UhD$]Éu։}}Mĉ$~G$D$$x1]u}]ÐD$4$~܋G4$D$yɋG$$EG$$EG$r$E$]$EGt$D$E$GUD$ EĉT$UD$$GU\$D$ E$D$oGUE܋EEЋG UEEED$ EЉD$E܉D$E$JGUD$T$$$E\$$U$E/U$$U$U$ExUS$M }]Ut $[]Í&tZCtStOtIztCzt=z t6EBEBEB EE$S$[]Ív$[]Í'U8}]M u}t]u}]Í1tzQtsQtlY teIt^UM$P$MUt$ L$T$lj$\$<$`<$Ѓt&cUtD$ $ËL$T$bÍUWVSogιƋ|431ߍ L*l!1l‹M1׍B9<8EǍ<:q11 M"amt11˹Í2 811ڍ‹MD꾤}11ιƍ8K}Ѝ4211 ;`K}11˹Í:px11ڍ>~(}‰ٍ11ιƍ8'}Ѝ4211 ;0ԋ}11˹Í:}11ڍ>9ً|‰ٍ11ιƍ8拽pЍ4211 ;|}11˹Í:eVĉ‹}11ڍ‰ 1ٍ>D")ΉƋM42*C E 1Et # 1˹ËM 9U 1U‹|Y[e 1ΉƋM42 E 1EM } 1˹ËM ]U 1U‹MO~o 1ΉƋp42, E 1EM C 1˹Ëx NU 1U‹M~S 1Ή}ƍ4285:} 1Ѝ ;*}э 1˹Í:ӆ} 1W7_ډWG Ĉ[^_]ÍUWVS,]u }CTSU@tDtdCTt}vt)?YTv?ECT u11@uUhCCTu,[^_]D$D$$X1Ƀ?v=u΍t&U)@y>C?CTwދuGǃ?t@hztCT?T ?tCT u,[^_]ÐUWVS,]D$D$$SKTȃ4 ƒ7AD E}8CTCEt&| Ȑ7uE)ȍ@7CTCECLCMCNSPCO؈SQCRCSUIhoCCCCCC C ,[^_]ÍA?D CTE&| ȍ&?uE)ȍ@?CTUD$D$$CE}1U1USeU1ҍ^Mڍ&9u-Ee3u Ĥ[] v'UE#Eg@@ܺ@ vT2@@@X]Ð&UE]Ðt&U1}t]ÍvE \EEEE E E$ E(Х r]ÐUWVSEJ zrhZlJpZtJxZ |J$MZ(]J,MZ0]J4MZ8]RyZ։#u! }41uÉuu7yZ}u!! `<9lj‹M}1yZMu!! ι uމuuƉuu3yZ]u#]! t ÉǍ2yZu!! u ‰ƋMuuUyZ#uM! ιuuhÍ7yZu}!! }41u‰uu7yZu}#}! }41Ɖlj}\;yZ]#}! ߋ]<9 ljÉ]M#] yZ! ˹pÉƋM]yZىU!! ʹ UUNjMUdyZMUU!! ʹ UUUÍyZUu#u! u‰Ɖuu7yZ}#u! 41 މuuƉu|}3yZ]u!! h É]‹M 1׍1n ulj}ƉuuMn 3uι ƉËM nU 1UUNjMUlnU U1U‰ƋMU n] ]1UɉUUn}U 3}<9 lj‰U|nދU 3u41 uÉu`2n u1ލ41uNjMud1nu u142UƉ‰UxnU] 3U‰É]\nt 3}<9 ljƋM}n] 1]]‹M]]n] ]1]]]Ǎn]u ]1 ÉƉup2nUu 3U‰Ɖuu7nߋ` 3}<9ljËM}1ܼu!! ι uu‹Muu1ܼMu!! ι uƉNjM ܼ]!#] ˹]Ӊ]]É]]ܼU]#]! ڋ\Uܼ}ƋM#]! ˹|Élj}}]ܼU}#U! }‰lj}}>ܼu}!! 41 uÉu}l7ܼu!! u<9lj}‹M1ܼu!#u ι uމuuƉuh3ܼ]u#u! xÉǍ2ܼ҉#U! u‰ƋMuuUܼuMM!! ιuuuÍ7ܼu!! p<9lj}‹M1ܼu!#u ιuމuuƉut3ܼ]u#u! dÉǍ2ܼ҉#U! u ‰ƋluuUNSu 1ι u\Í7NSދ} 3u41u‰up7NS׋u }3}<9ljƉuu3NS]u ]1 ÉƉux2NSUu 1ڍ‰NjMU1NSu 1uuËMud1NS u 3uuuu7NS֋} u3u41 މuuƍ;NS` ]3]uuÉƍ:NSh Uuu1ڍ ‰ƉuuU>NS}| 1׍<9 ljËM}1NSu 1uu‰uMu1NS 3Mι މXtljэ3NSu M3X˹ӉP]Í2NS X3P]XHUñXNSڋ8ҋP P3Hp‰L@ÉP7拢PDu <3TӋUD7拢Px T1ڍ ‹@@9拢PM 1ι uÉuM\1拢Pًu 3MϹ lj‹M}1拢P u u1uމuuƉud3拢P]u 3]ÉǍ2拢Pu U1ڍUƉuuUl拢PUu 3UU7拢PtÉޱ u3u42Uuuuƍ:拢P U3Uuu‰Ɖu};拢P|Ӌu ]1ӍÉƋMu]9拢P} 1ߍ<>`lj}‹M}1拢Pыu 3M<9}É}}7拢Pދh u3u41։uuƉu:拢PU} U3Uu‰ƍ;拢Pt ]uu1ӍÉƋMu]9$M\}M!! Ϲ <>ulj‹M}1$M\щuщ!! Mι uËMuh1$M\Mu!! ιu։uxǍ2$M\u#U! u‰Ɖu\3$M\]u#]! u ÉƉuu7$M\u}!! p41uE‰uM8$M\Ћ}!! ȹ ƋEu Í8$M\Љ#E! } lj}}:$M\U}!! ± ƋM $M\!! ً|ϹDZ M}$M\]щ!! ً]˹ ñ ‹M]$M\u!! l˹ñ Ǎ0$M\Љ#E! u Ɖuu2$M\Uu!! `± Éٍ7$M\щ!! dϹ DZ M}1$M\uщ!! uι Ʊ ‹M >pm 1˹ ñ Njp>pmE 1E Ƌ` >pmU 1U± Ëh>pm 1Ϲ DZ x>pm 1ιޱ uu‰ M3>pmt1˹ñ Ǎ0>pmEu 1 ƋMu >pmҹ 3U֋U Í>pmұ 1׋|DZ M}>pm U 1Uڱ UUƍ>pm U1± Njd>pmE 1ËEñ EE>pm 3E ‹\>pmًl 1ι Ʊ ËMuu9>pm M1ιƱ M >pmU 1׋UDZ ‹|U#U vmz! ʹñ Ƌtvmz؉!! ȹ‹l± UNjMvmzщE!! ȹE Ë`vmzuщ!! uι Ʊ ‹huvmzM}!! }ιޱ ;vmz}!! ˹ӱ ]]ËM] vmzUM!! ʹ׋\DZ ƍvmzUб!! ËEñ pEE]vmzЉ#E! ȹ‹E ǍvmzЉ!! d ËME1vmzuщ!! uι Ʊ ‹Mvmz}щ!! }Ϲ DZ M vmz]щ!! ً]˹ ñ Ƌx vmzىU!! ʹU± NjMvmzщE!! ȹE ËMvmzuщ!! uιƱ }11ϹDZ ]11˹ñ U11ʹ ± l11ȹ `11ι Ʊ p11ϹDZ |11˹ñ x11ʹ± t11ȹ d11ι Ʊ }11ϹDZ ]11˹ñ \11ʹ± h11ȹ u11ι Ʊ }11Ϲ DZ MPC?CXwދuGǃ?t@tCX?T ?tCX u,[^_]ÐUWVS,]D$D$$SKXȃ4 ƒ7AD E}8CXCEt&| Ȑ7uE)ȍ@7CXCECPCQCRSTCS؈SUCVCWUCCCCC C C$CC(,[^_]fA?D CXE&| ȍ&?uE)ȍ@?CXUD$D$$CE}1U)v'UVSp]eE1EuE#EgEEܺD$E EvT2EED$E4$4$(EECECEC ECEe3up[^]gvU$] t$uډTFCFCF C FC$t$]ÐUSeU1ҍtMڍ&9uEe3u Ĕ[]ft&'UE#Eg@@ܺ@ vT2@@@X]Ð&UWVSddYq`y1]Y Muލ&\\\\\\uְ`u‹M1yZM1!1ιlj‹Muu1#`3M3yZ `Mu‰UUƋMyZU 3u]1#U1É]7yZU}‹uč U3U#U3U]É]7yZ}3}#}3}U ]<9É]]‹MyZ]u3u#u3uÉ42]]‹MyZMڋ]3M!3M MUlj‹MyZً]1!3]Ɖ‹MԉUU yZ1#UM1ʹUU‹MUʉ‹M؍yZ }1!1<9ɋM܍yZ uU1#u3u41‰U‹MpU yZpʋM1!1щMUlj‰UU䍜yZU ]1!3]Ɖ‹MUU yZ1#UM1ʹUU‹MUʉ‹M썼yZ }1!1<9ɋMyZ uU1#u3u41‰U‹MUU3M1ыU1щʹ‰|UM yZ|ʋM1!1щMUlj‹M؉UU3U1ʋM1ʹ‰UUyZU ]U3U1!3]]ƉËM1ʋM1ʹ‹MUyZM 1#U1]É]ËMȉ]]3M1ً|1ى˹É]]yZ]<M1#M1 M]}É]]NjM3]1ˋM1˹Í>n}4M3M]]3]1э Mu‰1ƋM1˹É]]}3n]49M}13M MuÉ]]ԉ3]ƋM1}1˹É]7nu 3]u13]Ɖu}؉ƋM2n3}Ћu1ϋM1ϹǍ :U3U3U}}3}ԍƉuƋ|1ϋM1ϹNjMt1nt 7}3}1ߍ<9ÉƋMuu3M1u1ιƋMxunxMM11MMu‰ƉuMu3u1΋M1ιƋMlu1nl11MuljƋMuu3u1΋t1ιƉuu3nu 3u13]ƉuƋMuu3M1x1ιƋMp n 2Uu13UƉuƋMuu3M1l1ιƉuMn 7}3}1ߍ<9ÉƋ|uu3M1u1ιƋMuunMMM11MMu‰ƋMhu3u1΋p1ιƋMuh1nu11MuljƋthu3|1΋M1ιƉ|h3n| 3u13]ƉuƋMhx3M1u1ιƋhu n 2Uu13UƉuƋMhl3M1u1ιƉuh7n}49M3M}3}1ٍ hhÉƋM1ϋ|1Ϲlj}}7n}49M11э Mu}‰Ƌp3}1ϋM1Ϲlj}}7n}49ы}13h3} hMƉhuƋM1ϋM1Ϲlj}3n]t3u h]13}<9\É]}ËM11ιƉun]u3h3u]Í42]x}3]M1h1˹É]Mn\ ]3]3\ljl\Nj|3t1ʋM1ʹ‹Mt9ܼt< \\ #U! ʹƉ׉NjM}}3x1}1ϹNjMx}ܼx!M #\ MhhÉNjM}p3l1ϋM1ϹNj\l}9ܼl !}! MM}‰NjM}}3}1ϋt1Ϲlj}}>ܼu<1hh !! h }MƉhuƋM3p1ϋx1Ϲljp3ܼpM#h7} h! Ϲ<;]É]uËM3u1΋l1ιƉuܼ]U#U u u#h] ֍41É]|‹M3]1ˋM1˹Ëh]ܼU ]U #]! Ӎlj‹MhU3M1ыp1щʹ‹hUU ܼM #UM! ʹUƉh‹tUU3|1ʋM1ʹ‹M|Uܼ| !U! MMUɋxUU3U1ʋM1ʹ‰UUMܼhh !! Ϲ׋h‰h‹MUl3M1ыU1щʹ‹MUܼMu h#h! ι֋U‰U‹MUU3M1ы|1щʹ‹MU ܼM]! #h ˹ljډ‹MUp3M1ыU1щʹ‹MUh ܼM #UM! ʹUƉh‹MUU3U1ʋM1ʹ‹MUUܼU !U! MMUɋMUt3U1ʋM1ʹ‰UUMܼhh !! Ϲ׋h‰h‹xUU3M1ыU1щʹ‹MUܼMu h#h! ι֋U‰U‹lU|3t1ыU1щʹ‹Mt ܼM]! #h ˹ljډ‰UMU3x1ыU1щʹ‹Mxh ܼx #UM! ʹUƉ\‹MUp3l1ʋM1ʹ‹MlUܼl !U! MhhɋMUU3U1ʋt1ʹ‰UUܼ}9\\ !! щM\Ulj\}NjM3p1ʋx1ʹ>bʋ}4\pU13h hMƉhu3}l3bʋu1׋U1ϹǍ ;h3\3]}|3}Ɖ1׉uƋM1Ϲlj}\7bʋu 2U3h3UuƉu}ƋM3}1ϋp1ϹNjh}1bʋu 7}3}1ߍ<9ÉƋMht3|1u1ιƋh|ub|MM11MMu‰Ƌxhu3u1΋M1ιƋMuh1bʉu11MuljƉhul3u1΋M1ιƉuh3bʋu 3u13]ƉuƋMhu3M1|1ιƋhu bʍ 2Uu13UƉuƋMhp3M1u1ιƋhubʍ 7}3}1ߍ<9ÉƋMhu3M1u1ιƉuuhbMMM11Mhh‰ƋMut3u1΋M1ιƋMuu1bʉu11MuljƋMux3u1΋M1ιƉuu3bʋu1l13h3t3| hMÉh]Íbʱ3uƍ 2h13Ut]É]]bʱ}3x3]3]Í U3h3Uxlj}׋p3l3U3U‹h9bʋM3M3t tMljt}NjM3MMM1M1uuƉuu>bʋ}49t3M}3x3p3} xMƉxu1ߋ]Ǎ3bʍ9x3t3M ]MuÉ]]3]3]Ʊ1Ët1bʋuڋ]3x3]Ɖ|u3U3U3U‹x1bʍ U3U3UUuƉEu3E3u3E±11`ËM9bʋM‹dUPX]H XĘ[^_]Í&UWVS,]u }CXSU@tDtdCXt}vt)?YTv?ECX u11@uUbhCCXu,[^_]D$D$$X1Ƀ?v=u΍t&U)@ >C?CXwދuGǃ?t@h:tCX?T ?tCX u,[^_]ÐUE]Ðt&U1}t]ÍvE \EEEE E E$ E( |]ÐUWVS,]D$D$$C ?CdwދuGǃ?t@HtCd?T$ ?tCd u,[^_]ÐUE]$Ðt&U1}t]ÍvE hEEE E E E$ E( ]ÐU1} t]ÍvE hEЀEEE E E$ E( ]ÐUWVS,]D$D$$S Kdȃ4 ƒ7AD $E}8CdC$Et&| %Ȑ7uE)ȍ@7CdC$EC^C`CaCbCcC\C]S_UHS$S%ˆC'CS&S(S)ˆC+CS*S,S-ˆC/C S.S0S1ˆC3CS2S4S5ˆC7CS6S8S9ˆC;CS:S<S=S>C?CS@SASBCC,[^_]ÍA?D $CdE&| %ȍ&?uE)ȍ@?CdUD$D$$C$E}1UQUxD$]uƉ$Ft'ED$\$$xu/؋u]]3$艾t$$`D$!$ft$$sD$&'UWVSEeU1҃}D54MTFLPDžH't&HDžHEM 1\󫋅LT\T$P\DžDžD$ D$D$$k}vfD$ |$\$4$9~xD$$DuYxt$ɼ$lD$et&D$D$$xUT$$%U D$@$T$D@)EEfE䐍t&9u1Ue3uv[^_]Ðt&迻$$D$T5 ƣƣUSeU1ҍtMڍ&9uEe3u Ĕ[]ft&'UEɼ@g j@;ʄ@ g@+@rn<@6_@:O@ т@$RQ@(l>+@,h@0kA@4ك@8y!~@<[@@@Dǀ]ÐUE؞@]@|6@ *)b@p0@ZY@9Y@/@ 1 @$g&3g@(Xh@,J@0d@4 . @8O@<HG@@@Dǀ]ÐUWVS$pXx D@@^vI,HLK v([$` d^8@0I4v<8p4v HJHJHJHJHJHJHJ9upppPHP؉HPTpT\P3\X1ދph1ߋXh1phXlpPxT3l3hhp1h1PH;DžPhl 8`4d \XdD`@LhHlhlD@P`d`ptd1ϋ`X1ދdX1ދ`,1ϋd( (,#`#d#8#411 $@H D$L#@3H#l#D3L#h1h1lhl1΋hX1ދlX1ދ1ϋƉXH\LӃPPP48J48ǃw׋uGǃ8tuTH&\ uރ,[^_]Í&'UE]HÐt&U1} t]ÍvE EEE@E E E$ E(@ ]ÐU1} t]ÍvE EEE0E E E$ E(@ ]ÐUWVSL]D$D$${Ds@EU1MĉUUM9Mr@EU։u؋u}܋} oU}p{HpDH}t*LIt&ou)ƍFoCHEԋEEEE䈃UEUEUEMEEEE܈U܋EU܋EU܋EE؈UԉGCSHSISJSCK׉׉CNKLKMCOC SPSQSRS CSC׉׉CVCKTKUCWCSXSYSZSC[C׉׉K\K]C^CC_CS`SaSbSCcC׉׉CfCKdKeCgC$ShSiSjS$CkC ׉׉CnC KlKmCoC,SpSqSrS,CsC(׉׉KtCvC(KuCwC4SxSySzS4C{C0׉׉C~C0K|K}CC<S<C8׉׉C8񈋅L[^_]ÐpDH&LI&u)ƍFD$D$$/SH1׉U@9UUWVS<1t&E<$͎諷9/D$4$D$Q $艰EAtD$P $mE%qD$t$$_ e$Vu1<[^_]Ðt&U T$UT$UT$UT$ UT$U T$U$ЅtU :uU:uU:t} tU:u돍gu"D$t$$_ 襱C$ dUWVSUE JM 1MJ1MJ1MZJ1J1J1ˉ]rJ }1J 1J 1ΉuJ Z 1ZR1ى1ыU׉|U؉Ӊ׋U]}]Uċ|ӋU]Ӊ]Ћ]uӋUĉ]|ӋU]ȋ]}֋U]ߋ]ȉ}}߉}̉ߋ]ӋU]ӋỦ`։Ӊ]`Ӌ`]ԉӉ]}ӋUԉ]]uDl]؉puh;fډ}33 3]]}߉]}333 u11ӁXz]܉1ցsL3]}}}}<}}<1}< 1}<]1}]}߉]}333 1]u1/7Ɖuދ}O]]}]]1] 1]<]u1}4343434 1u3U3u3uUSTUoU܉33 3]}߉]}3}3}3 1]]1U}1}}1Ӊ]]׋UHLUӉ]]Ӊ]LӋUX@L]PDUӋUdӋP@XLXDxLӋd]XDX@U܋d׋PL1]]]܉4u3u]]]]]xxt]Ӌt]}Uڋt]TU}PxU䋕T]䉽(},PӋU}3}}u}ċu3u1ω}ċ}upL1։}8d!3}!1΋M1MM1MȋM1MM1M̋t1tM1MщEԉt&'U8]]uu }}$9$;|$ t$$D$EAE]u}E]@UWVSE }$i>ƋE$\>F @ *f\$t$<$\$4$<|$$<D$$uĉt$<$;4$?$?<$D$[^_]UWVSLEuEE $=4$=At&D$4$@uED$E$v%U҉E~M1}t&9uUUu[D$ D$D$$-D$ D$D$$l-UWVSLU EMuE܉UM؅1ۉЍt& uEE]}ċ]v׉$9}ÍWu]ԋ]}ĉU9vUԅG ٸ$ EE؉$#$$%ED$U܉$>&EԅEĉEe̍4Eu&U1ۉT$ M܉L$L$EЉ$U+U}uĉUfMۉL$$tyޅ9]E<toU؉D$T$ MЉL$E܉$BEU9UbMЉ $g)u1ۋ}&$J)9|EEL[^_]Dt&1ubs#tCE؉D$ MT$$D$;u|̅M$#:M$:'$$UD$ D$ID$$*EًEẻ$s(}#D$ D$8D$$*D$ D$?D$$az`*D$ D$>D$$<*D$ D$@D$$*U1VSUZt r1ҋt f u 9r[^]Ív[^]ÐUE Ut 1Ƀz~JI1Ƀz~J HJ1~B]ÍvUWVS,]UC;EE1ɋUB E \9É]rV؋z+E E؃EvBZ2 Z  ؉;MuԋE؋]Ѝ]E 9ErLU9U w2]S Љڃ9U wS Љڃ9U w S Ћ]SE;M܉Hu ,[^_]Í&D$$!D$ D$D$$O(t&'UWVSÃ,ɉUt@ sE0ufEu$W4$臂ƋSуUx71ߐW \\T;Euр>u9Ut0Mt&t :t9tD$T$4$,,[^_]Ð4$0d'UEMEU t&UEMEU t&UWVS,} EE܋EW WE~ZZ4U vGEG;U 0/t-L$ D$D$E܉$($EWtDE,[^_]Ð<$D$%D$D$ E܉$#EE,[^_]ÍvE$0D$,E,[^_]fE$-D$,EE ,[^_]#&'U(]uu }}&<$l't$$D$u] }E ]]1*'UWV1S,] <-<0t,[^_]Í{xu$'MxW;M҉UQq ߍ4u1҅0u&3NЃ v NwgNp v pwap  1~u1Nu1muz1t&fNwN돍vpwp 땋E$U$yT$E؉U܉ $MU܋ED$ D$D$$6#D$ D$D$$3#v'UWVS1ۃ,E ME8y ǁ@Ew^$MM؉EU]z}ZB t`uڃ4u܋E 89we19wY1 ~uVu܉21҃muut&U E,[^_]É$MM؉E[f$9%E$1 U EE,[^_]É|$$.1%또&UWVSNx$440t&u[^_]Ðt&1ȍUWVS\}}Eu}EE\[^_]ËUE+E}uE܋E}U}؃ u܉MU΋>u9EM UD+EExuMUuu9u ỦMfmU܋EUEĉU9EtUuȉщE4EeUv;E‰ׁ)}+E9Mw uU܋};:vى)߃m9vʋML$ ut$}|$E܉$9Ett$ |$U܉T$$mM̋uEȉ1m8Mu9u !UȋEUxM܋UM12uME}|E_}Ћ7H9ىUOEU }|:} EUډEԉU1&;Eű}ԃmm7u)Ӄ}}9} rm9ˋEЋEvƉӋE< u̐9vˉ)΃m+E9v덋UMuE:T9E MuEMx)] M܍uM E+Ex 11&9] uuE\[^_]9w9+uEfrD$ED$U܉$HML$ ut$}܉|$<$;EE8)Et&9ivU9EsD}ԃm+]u܃mu}?EЃEЉ0E\[^_]Ðt&1ҋE})Љ‹E4UWVS,U܋}MD$ E܉|$4$D$~SU*vU܉D$ |$4$T$U9~UwtU19,[^_]Ðt&E܉|$ t$4$D$A뮍&t&1f~B9u1Qv~ M1&9u1*1yUWVS,} Uu$UD$ t$|$U ~OU)t&MD$ t$|$$M9~Ewt19,[^_]ÉMt$ |$T$$)M붍t&t&1f~:9u1Zv~1f 9u1;닍t&'UVS]C t$Ct$t/C 3t$Ct$$pu҃[^]Ít&'UWVSLu EEUM]t$$M܋UEEU܍4\$D$ M4$L$rUMڋD$ ED$U܉4$T$LM]L[^_]Ív]*M܍}EU׋UEĉM‰UЉt$$E\$M<$L$\$ E|$D$U$E\$U܉T$M؉ $OEẺEԉ\$ U܉T$M؉$L$u$MԉU~$EU 1t&9:9uMU\$  <|$MЉL$ $E؋EȅEt$D$ UԉT$$M)M؃C$M܉UKEt$D$ UԉT$$)Ut"9Љvڍvt t~M1&9u\$ ủt$MԉL$ $EЋMЋB9‰Uσt&tL[^_]Ðt&U܍}MENjEU؉MȉщEЉ$T&$@vUĉ$D$MԉU>Mĉ$D$M܉UEt$D$ UԉT$$E؉EovEẺEԉ\$ U؉T$M܉$L$5\$ |$ML$E$EEfUWVS4E$Yg1^T$eM]UE@@@]ÍvUU]E u}JZ rzMJM M HJHJH J HJHJUMxpX PHU]u}]Ð&UE]@Ðt&UE]@ Ðt&UE]fUE]fUE]@Ðt&UEU @ttH @$ t&U]Euu u-u]u]]d]u]]b&D$$ 뾍t&'U uu]uW$c1tD$4$SC؉3CCC C]u]ÍD$$0; 뒉'U]uuuW$c1tD$4$C؉3CC CC]u]ÍD$$F 뒉'US]$ZP1҅‰P@ []Í&'U]]uu 93sCt#T$$`C3]u]Ð$bCߍU]]uu ~0C01CC CC]u]fD$$H뾍UWVS,} U_G ;EDEۋOp~1t&9uUGZBGBEB ,[^_]Ív\$$fUS]tBu][]_v$^$D$][]^[]Ív'US]tJCu4C$E CCECC؃[]ÐC$^ʍv$<릐&UVS]CtfC$buGC$<`ƋCS4$D$T$Ct$$D$-[^]ÍC$^뷐u4C$S@@ @P[^]Í&C$ʍv1뗍t&UVS]CtfC$KauGC$l_ƋCS4$D$T$Ct$$D$][^]ÍC$]뷐uLC$K SH K҉PHKH~p1ҋ[t& 9P[^]ÍvC$1끍&'U]]uCusCCuuP]u]Ít&D$$(K~1ҍ& 9SC]uu]D$ D$D$U$iFfUS]tRu9Cu#C$Cu5][][fC$[ۍv$mf[]$w&'US]C$;E CE[]Ív'US]$ZCE[]ZWVSU|$t$L$l$ <41f؉Au][^_ÐWVSU|$t$L$l$ <41f؃Au][^_ÐWVSU|$t$L$l$ <41f؃)Au][^_ÐWV|$ t$T$L$؃tA)))Mt&FBGFBGF B G FBGFBGFBGFBG v R Iu^_WV|$ t$T$L$؃tA)))ݪt&FBGFBGF B G FBGFBGFBGFBG v R Iu^_WVS|$t$T$L$1Jt.Pu؍&؉JÉJuX[^_[^_ÐWVS|$t$T$L$|4ڋ1Bt(Pu ؐ؉BÉBuX[^_[^_Ð4Ut]fL]4Ít&(Ut]fu]É'U,Ut ,]Ðt&U,]Ít&U0U]0Í'U(4Mt^(t,L$D$T$ D$D$$fL$D$ D$D$$xfL4떍t&UWVSuE} $ft811ۍD$D$D$ 4$9މwҡ4E E [^_] U$E D$ ED$D$4$oÉ'U$uE D$ ED$D$4$/,fU$unE D$ ED$D$4$É'U 0uPD$D$$H$ E D$ ED$D$4$Í&,D$D$$$맍vUL$ D$y$E D$ ED$D$L$ L$dY3 UD$D$$RUT$ U $T$UT$QU$E D$ ED$D$4$oX$v'U(Eu fD$D$ !D$D$$Í&'US]($YTt$V([]f([]USE] 4t;Lt;t$.t=ft&D$<$4t)[]Í&L4t&4ӡL4$\$$<D$oD$^D$,$&UEt8-t ]Í&xt&u']Í&UEt8-t ]Í&xt&ul]Í&UWVSL]EEBEZEhEEEEՋEEEEPEKEE$DŽU $\ED$$gED$EĉD$$Pp1҉EtT] Ѝ|u98u؋]1$\L[^_]f1L[^_]Ít&E 1ύvE 1L[^_]Ív| SEHM 1두t&E ]vv'UHt&U]]uu $t$¸u ]u]fED$\$$Et ]1u]Ð8D$t$$uՋEU3<38 uUE3E3U 낍UWVS,u}4$}XE t!t&$UaU؃\Bu>~tou$lRËE$D$Eu t+t&D$d$t$$wuڋU$P,[^_]Ðt&FEFtz]u}]ÍEɗ]u}]PUWVS,U:tc<|t]t&1 t&|t[ ބu1Et1D$E $D$:tC}|t4t<|u,1[^_]Í|E|밐t&s{Ã,[^_]fU8D$]]uu }D$n$sD$D$x$UD$D$$E6D$D$$E\$<$Et]u}]Ít&E\$$t3E|$$t{tE܉|$$D$4$tD$$kD$$tOQ|$$mt {+|$$O{1{_1t&t&'UWVS,]D$D$$D$D$$D$D$$ED$D$$aED$D$$BED$D$$#E܉\$4$t 1,[^_]f\$<$t ,[^_]É\$E$tLt$E$t{tt$E؉$t{tt$E܉$D$$qD$$tN6t$$ct {1t$$E{{qf獶UWVS,]u D$D$$D$D$$ED$D$$|ED$D$$]E܉\$<$tD$E$]t{to\$E$ultD$E܉$'t{tID$$ t%t#D$$t {u,[^_]Ð1,[^_]Ít&UED$$Ðt&UWVS}}fD5܃$D$ /D$D$D$]9͋}E1MEE(D$$M+]CEЉ9ډM؉E$f34$EԉÍẺD$EԉD$ EЉD$E؉D$AtvEU$'14$@}}1D5܃$D$ /D$D$D$_9U1= tQE $0$0UM ET$L$$AG$(D$D$l$UVU|$ D$T$$Y(.U$/ME UL$D$$:D$D$$gVfUWVSL5]V ($D$w1҉پu'tyur4$U$1]$UԉuU؉E܍E؉D$ED$ E܉D$ED$<$E<$L[^_]Í*1ɉ߉ھtLuq4$0Ɖutt&tay?ȀBٍt&$0L[Ɖ^_]Ít&t,\$4$m,t&L[^_]$( (D$D$l$MЉEUD$T$ MЉ$L$z($t&U8}}u1]tTSы1!%tꩀtD)у $U/UT$Ɖ$r$-]u}]Ív봐&UWVSu }4$ $.@Í@t$$ tf‹u؃[^_]Ít&؃[^_]Ít&UU]E u]u/$$D$a4$7,؋u]]Ív]u]:v'U(}} ]uu<$ $-@@|$$4؉]u}]Ít&'UM]E u]u/$$D$q4$w+؋u]]Ív]u]Jv'UVS]-$ ބu3(1[^]fD$4$0tD$ 4$tD$$4$tD$*4$yD$94$ܥ(1\t&D$D$$Cs<_t<-f$hD$4$=aD$$tP$\$$tK$o1(1ɺo1ɉWUWVS] tRu11&19] v.D$E$et݅uۃ9] wٍ&t+}} E [^_]ÍvUE D$/D$E$pÍ&'UWVSu tUu11&19] v.D$E$t݅uۃ9] wٍ&t +}} E [^_]UE D$/D$E$pÍ&'UWVS E8U&:tp DK u ]Ɉ t`M1v1ۈt'2Ds tuۈuߍtE [^_]ÍEE [^_] UWVS,u }(u܉}؋EԋEEt&UMB9 u]M܃UЋE؋UtCu؋}74;4u/M܉M&:<;$$w%4$؋u]]Ð]1ҋu]4$ эE8Ee$t@묐uU&'UE]u$$$ ]u]Ít&U8u,tDÍvDꍴ&U8u ,tEDPÍvK␐U1U w@%]Í&U(E]uttv]u]Ðt&$$ $ t$\$D$`D$D$ L$þL]uE]]$)]$$L$(7\$$_$ USÃfxxXH@@(@ @$@,@0@ |C[]Í&@ tCtqFvZt]T$$& D${ {C C[]Í&T$$D$빋T$$!D$롋Ct~f)C(KD$$ FRT$$D$*6t&T$$D$ t&C(D$$\!$ t&T$$D$t&T$$ D$t&C(tmD$$4!yt&C(thD$$B YeC(tSD$$[ =IC(t>D$$x !-= 댸= = = 둸= 릸= $US$ '\$$O$ tD$D$w$觻$ D$4$D$~f$tD$D$$Xu$tD$D$$($ htD$D$$$@t$T$^$t$T$<$t$T$(uڡ$ɽ[] UWVSÃtT1$ D$~$ D$9|tf< ?$ D$fUEE t $!S$t&$ D$$D$$论$$T$׿=I$ D$诿~1ېt&$ D$茿9|fUD$D$D$ $臼UЋBD@< u5t&?$ D$< tЋ$T$א<=t.$ D$¾<|t1&$T$葾<|u<Xt&t?|t h$ D$PU<|tu<U$T$<|t uڋUU뿍USÉЃ Stt:tK[]Í&D$D$ $蠷C1[]ÐD$D$ $pC1[]ÐU1ɉ1WVSL] {sEUu+CEEUCsL[^_]Ðt&uCEumfEEtu؋Us$C(uRu؉Mԍt&8-t{S @SC$MK$C(t΃MuC]fSu؃t琍t&CCCmE*&PUP-tynS u؅C C E Eu 1]ԋE ]܃@t\$$u׋]cfHC M@SEmC$MHvu؉U܋U ҉UBE9MЈEU  f9ȍWCׅuUuEEUЀ}?ta}ht[KGM%C CK:t}tmEC {S@uE f둍u؋MԉCuCCmEIWtXM܋}܃EE9-@y6-}к"C}0UCC EEUɋu؉UME ËM}ȅi"M܉u؋UƋ}؋ED$= $}̉EЉUEt }7U :]ċE ]܉1U@t\$$Au׋}1]E 1]]уMĉv؃!@tU܉t$$T$訸uЋM ]T:t=t t&BtUċM܉$T$L$\uԿuԅtE=} CWMԅMMԋ}ԃUCU}Ћű }{ uغ"m]} EE]AUԅCE댋U$_T$虸u/S@fCEN]M$L$Su8C@ut&$St}UCU"*E$ D$U$ T$u U>=FtD$D$ $&ӋMк"CMEU}t0\} EEnE܋} E9-tbXM}؃EMЉ}M܋}  MCMCMEE[tCE t&FuMCKAU*U ECxD$+D$$!D$ 裲$臶$$c$gvUWVSEM]U tEhe M1Ʌۉlt1hlUDžXDž\DždDž`DžpDTf$Lt^ tYtftՃfpbrhA떍t t -t&KDžp1ADx .#mfvǮDx NplDžpD:tYT`Ӊ1vCtML$$PXPtủp׉ڋ`hpx:`hD DžXUE]ÍvUUM SE u-`PP HHPH@ @[]ÍHэv'UM]A QAQÍUUBHt]ÐыRLuy<`uQ@JuB] UEt‹@Luz<`t1]fB@]UE]Ð&U$p]uu ËE4$&s$C\CHC0CPCT]u] UD$ $vÍt&UWVSÃ<5ȘuffUt$T$ D$D$S@$ЋE{,K(S4te|$L$T$D$ CTD$CP$0D$+[Lt,C?FF1FFF,[^_]Ã>s^1҅ Ș=4$UGU؃,[^_]ËF\$Uȉ$T$΁1^Ѓ,[^_]ËE$ \"\$UT$M $#,[^_]ËU$$3́fM $UUOE$UUFF}1/Et$$/ dt$$B/UU~ s^Q @D$U$Mz$z$p3D$迀F$U|UFF$$/芀1D$}<$ uD$<$ u%D$<$WljD$<$@ÉD$<$…'C\$FD$E$#$NFa\$E$aD$6D$v$-|$M $,hD$ #6D$ D$-$.U|D$6D$=$-赀D$ #6D$ D$-$.|$UU؉FD$ #6D$4D$-$.{D$ #6D$3D$-$.{D$ #6D$$D$-$.{D$6D$$-D$ #6D$D$-$eO{t&'UVS] uu 1t&D$4$t[^]Í&1[^] UWVSL]EK ;y$p{lj1KHt $UUԉBHC<C@CDC4?<C$$UUC,C(C0B\r zrC\E zSLcC$4qv$5q$<9F@uNjCLS0߉$ESH$ EԹ1$ Șt4CTD$CP$m0D$o$$5.D$oL[^_]ø"CLS0߉$ESH$}EԹ1$gL[^_]Ã;f4$h$V$H4D$Voj$4Up$p4IpD$ 6D$D$-$/lD$ 6D$$-yp'U]]uu $ 2Jw^u;tEuغ&]]Hp@ @$D$D$&]u]Ð$,5,nD$ 5D$rD$-$0JkUS] CLt&S‹xlA$8D$gE$gt9|lt|$llE$轿Ut|Yx|Qq q9҉|| pfxQD$$6T$sft9|t|$'`xA$.8D$ift9|u_Ɖ$`xD$B$6D$+ft9|t|$蟼12gm_RfU(]]utxCuqs tJU|d_9u\MtUC$eupC 1]u]ÍvC$L8D$d]1u]Ð]1u]Ít&t$$6e$6d뙋C$ 7D$d|'U1WVSL]KS 1fCD$C$ h-^ƋUu=>L$8d$t7vd1C t&L[^_]ÉE ^U9tϋEtb$D$U hUԅtH>uCD$D$7$aUԉT$$cC$uct&} tt&9tH uuuuwD$ T$D$u$7cE܉uED$D$ D$D$$c |t&8돐$81ۃ,[^_]E{0!&UuE USUҋDP 1뤐&UVS ]Eu D$ D$D$$3tGt)؉E$Yt"D$ UD$$T$t) [^]Åt]M1 [^]D$9D$$9TUWVS,}]E1EM9t&9~ Fr~rUM EE9EE}tuut<:PvPЀ v PSzrv vzwf<9`pXt&<:uEf:t(t0|!U܍QUʋDH uv,[^_]ËM9Mu؃+E,[^_]UWVS,E]E1ɉM4v9~ Fr~rUM EE9EEvWPvPЀ v PwFt&Szrv vzw <9~p|t(} ,[^_]ÈUPUʋDH tېM9MuҀ؃+E,[^_]ÐUWVS\uE}eE1UU MNt&)~B v EUD$ \$D$<$bRE\$|$$UUtUe3u\[^_]R'U(]]uu};SC 9s,C E t$$D$O1s]u}]Ð0CD$C $Jt C S벍vIt%SC D$T$$Kf ׍t&wI8넍v'UWVS,]uK st:C;9r;t*9s&ϋU t&9v{   Cu,1[^_]Ívt$U $T$N1s,[^_]Í'UED$D$ ED$E $OɃÍt&'UWVS U EM]4e5u18d0DžIHd҉<, d։HDžlDžtf <%u%tۍB<wpƒ0hF`FxЉ wEp`׋ht&tPPЀ v艵hp`<$,DžhDžp1ɍt&B< *pB< 0HЀ w3&u<0TPHЀ v܅DžL.DžPDžTA<.DžXA7Dž`ft9lll 9\!(D$( $G(@11DžlDv< <| || || | | || || || || | | $|$(;tr;HD@$$(I$(Ë\lt)pÍIXp`PT`HLpPP hHp P@$tt&tpLp11ɋtt&Pt9}ӋpP 9}9}Ӄ(9rօۉpzt=1ɋt(!z v9jpƒ(t zuًruҍHl$8: t&p1ɺA<.DžLDžPDžT,$|:f뫍v룍vt&떍t&농t&svɐt&$8;`f$<@$tYvhDžL0T9Ƀ0LGWHЀ w(L LHXЀ v艍L<$zJ&<*HЀ 0THЀ wBT`֍u<0t8LPPЀ v`TDžP~p<H9ptp$FDžpp$EUe31 [^_]Ë\ÉlGt&DžL<-TDžP-DžTDžXDžXDžXDžX?l DžXsDžX?huуDžXƒDžX=X@$t@$tXd1҉Xƒ P$twX|@$UXp@$<&``PDžp DžL!R p1ҋtx t(xtx(9s hB  >  19s <uhAuAx93 t$4\$4$8h@@9)؉T$$4 8tyfh{$4D$D$4$8W\d`h(dhƅ!C$ ; ۭhEF$=hƅ!~hB$ $=D$ J>D$KD$&9$X9y:h B$4$=y,$17C lD08d P ЋhB 6FlD8 @hA؉AIDžX,hQ+X9)9) D$8$4&ƍHۉof4D$D$$8uÃddo@$@$@$@$u@$h@$t&X@$t&H@$t&8@$ t&(@$ t&@$t&@$t&@$t&@$ t&@$t&@$t&@$t&݅1F$$=1ɍEӃ9 u⋕)ƒw)ƒJd0v@xP@04T$)Ӊ\$4$81hBwƅ!+DžX ٍ}hP H11 t !9փ)ޅ!\hBtRBQt+40D$84$:4\$|$$8hAA+X)9zQ@7@uۃƅ!-DžXzf빋&1MEat MELhX t1d~d̉؃)ÅҍC0ӈu.hBt#AA%S؍"|$D$ D$^D$$:$47"-ThV`ƅ!+V+TDžXuhQx+X9t0!D$4D$$8T4|$)\$$8hA1A&+X9)T$qMEGUMEgIMEE=MEe1MEF%MEfMEA fhBaX?p9t_9Eڃ u勝hKtXNjh)ËV pA1DžXƅ! DžXrٍ"\$D$ D$^D$$8!D$4D$$8o!1ɉߋTX4\$D$4$8ƅH)l$}5DžTPJ$t$D$ D$ 20$t$D$ D$ 0щ t=hAtTTuPtDžTyhN)V hƸ-ƅ!-DžX#Q{Eڃ0 وu拝hK0x@0hH)P HpD$<$.lat9D$4D$$8qhƅ! TDžXP |hP+X)9! 1эY9) D$8$43 !)ع T$4$8D$ J>D$+D$&9$B9.1UQ3D$ J>D$ED$&9$ :.D$ J>D$1D$&9$9.D$ J>D$;D$&9$9u.UVS ]EEE$贉Et]EuD$ E t$$@]D$D$D$&9$9k-&UED$E D$E$ U8]] uu}}E!EE]E|$D$ E$^D$tIt uU܃]Ћu}]ÍtE؅tڋU9wD̍&D$D$u<$띍UED$ ED$E D$E$Ð&UE$^D$ E D$ED$9Í&UED$ E $^D$ED$ Í&UE D$ E$^D$LD$ÐUESJЀ w.҃0HY DvYDw3[]ÍJw҃7Ȑt&Jw҃W밐t&YɀD v뷍v'UEPw]Í'UEPw ]Í'U1҉1WVuS] 9t5t&Hw  yw t8t)[^_]f1UWVSE}u1[^_]Ð1;} tKw u  qw t t8t)[^_]f1UWVSE$(,ƋE ,t9$s,(t&$\,/tYƃDu4$tE(,Åu   uu[^_] &%8tGLD$D$$z>D$ ,$0$xt뙡LD$%D$$T>D$ ,뷐UE Mf9v]]Ít&UWVS ] eE1ED$t$ D$!D$$. v=~/DžUe3^Č [^_]Ít&FuVfffuDžfD$<$(|9DžDžL$$I%r1tft;T$ $6(Q)ƒ:P f!$HP f PH P fH fP fWH fOPfWH эPG fOD$ T$D$D$4$+Ip H9Of98‹91D$ D$L$$-#1DžDžfxfWiȉ/f9u'Hf^9Nj9N$(!Ɖ$!1҃DžDžDžٝ*9مۅɋ  f@ss4t&f;u2A9f؋؃9> ٽi ft&34>f;0p9ۅ٭P٭w& $#Dž&$#\v;Nj󥋍<4F1t ft;b1t ff;؋Ƌ<421t ft;1t f>2ff~eD$ D$L$$f-fIff$#É$H$U1Ut 1]ÍUWVSÃ#&L |$t$$Px)ƅu1[^_]Í8t[^_]ÐUH]]u}  S$tdEXU\$D$>D$T$D$ C$$C uW|$t$C$$dC$$ D$U%Ƅ; OuAǃ ]1u}]ËC$D$D$$>D$ 1"뗍vǃ 뽍U1WVSD$L$D$ A$$EUp @$D$D$$>D$ !UMA$$ D$U#U UOEd1ۋUfDB u ؉ӉƒF< t=<%t9< t5uЉщډE &F$D$ GD$D$D$U"U띉|$ED$MA$$UUEǀ <1[^_]Í'U1ɉWVS<} ]ut <$D1=C$t}MEU\$D$>D$T$D$ C$$BC MEt$MD$C$$MC$M$ D$"MU<[^_]fS$1t@MEgU\$D$,?D$T$D$ C$$C$MwR)9)&C$D$D$$>D$ qM!t&)9f(U=b1UH]]uu }tnD$ 4$&tnK$)t7E6U\$D$d?D$T$D$ C$$`|$ t$D$$]u}]Í&4$,ȍt&US]E Ut tt[]Ít&u$T$D$$ u؃1[]f$ uCuE \c][]t&'UWVSÃ,E ɋUte]+UD$D$ 4$ku;)t3U䋂L \$t$$|&uE ,1[^_]Ð,1[^_]Í8t,[^_]ÐUX]]u}K, {0C,D$E$(S$tM$ |$\$t$D$?D$D$ C$$?]u}]Ð t$D$<$ǃ t$D$ <$Jǃu)919tz BIщ)s$1gA \$t$D$?D$D$ C$$nK uC|$D$C$$JC$$ D$;1C$D$D$$>D$ 1뱍vJ)ƍ UԉL$MЉt$$MЉt$D$ $Uԉ t&C,D$E)$T30)EfC,tl{$ \$t$D$>D$D$ C$$D$ ?D$~D$>$>KD$ ?D$D$>$>'ǃt$D$ <$udS$t33 \$t$D$?D$D$ C$$`{,C0ǃl US]t$EU K0 U []ÐUWVS<]uE {0$ujK0t#t҉U~KDtTS}t6O}t&E}I_Et&t& <[^_]Ð uU NuԀDuW tҐuU 봐t&W UtZU {1 ufL0 tkt&K,W UtU {2 0t&L0 tt&RRfW UtU {3 L0 tt&NQfUIt&|RrEhW tWU L0 7}ft&'UWVSL]u $t$#C0EЍvMEL$D$$*unUMЋщMԋMtLbu-E!ED$D$$UyL[^_]Ë}0ɋ})tm]׈ZtA1%u~ߍqI9wSN9wV0J׃Nu]ĉ+MEԉL$MD$ $UQNp9vFw 7룐t&Wt&딍MɍvEԋMD$ $UD$D$$zRt&U ҍv:EԋM$D$ $U "]D$ D$$FcewU(lEԉD$E,$U(Mԉ $ D$D$Eԉ$t1D$\c$ EMD$L$$  U8E$D$$D$ D$E D$ED$ED$ED$ ED$E D$E$ÐU1%(UktMvSwAtA}*t0Bt~At BuSvÍ E@te@t{@t V@t g@tt&T$D$ KBD$2D$$  Ít&qBAb$tuAN(rZA:sjAuÍ)vp@ \)@8Íh@fjf@g@Ít&Ҹ?$Í&zAbfxALyAÍt&n"A*w`lAmA\f@d@,[^_]fU]]uu t*C$t$s$]uu]'&]u]ÐUWV M u}Uɉu}EuEϋuUu9v9щ1 v9vL11ɉȋMt؃ڃ ^_]Í&u 1ƋM1lj뾍ЃUuE;uv9s1뛍vuڃES]UU]At&ME +EM UuMUU ׉u։e9։Ur UM9s;ut1t&O1UWVEUu} Uu59wau 1ƋM1҉ljȃ^_]Í9wЃUu9;u911ɉȉ^_]Ðщ1ȃ^_]ÐME +EM UuMUU ׉u։e9։Ur0UM9s;ut1qt&1`t&O1ȉ^_]ÐUWV UM}u ҉ȉMu9v?1҃ ^_]9wLʃMuQ;}9E ^_]Ít&u 1lj1E멍t&ȉ ^_]Ðt&MU +UUMM UMU}MUMM ։uue9r?9r3M)։MM ^_]ËE)։E)9uɍt&+EU뽐U]Ít&'UWVSO9+)t$1ED$E D$E$9rރ[^_]Ë$ÐUS۲ tD$ED$$ []ÐUS^t^fЋu[]ÐUS[lY[on exitconflicting commands can't create `%s': %s can't open `%s': %s ../../g10/gpg.citem==0 || item==1 || item==2/usr/lib/gnupg;usage: gpg [options] %%%02X%s: RMD160 = %6s = %*srb[stdin]gpg.conf-1.4.10gpg.conf (%c%d)gpg (GnuPG)GNU/Linux Home: Supported algorithms: Pubkey: Cipher: Hash: Compression: /dev/null/usr/share/localeCOLUMNSLINESlibpcsclite.so.1option file `%s': %s reading options from `%s' --export-ownertrust--list-ownertrust--pipemode--list-options --show-keyringclassicalwaysdirectautounknown trust model `%s' --force-ownertrustinvalid ownertrust `%s' --show-policy-url--verify-options no-show-policy-urls--no-show-policy-url--no-comments--default-comment--show-photos--no-show-photosinvalid keyserver options invalid import options invalid export options %s:%d: invalid list options invalid verify options --show-notationno-show-notations--no-show-notation--keyserver-options --honor-http-proxy--no-auto-key-retrieve--auto-key-retrieve--import-options --merge-only0xshort0xlongunknown keyid-format `%s' invalid auto-key-locate list gpgconf-gpg.conf:%lu:"%s verbose:%lu: quiet:%lu: keyserver:%lu: reader-port:%lu: %s %s; %s using character set `%s' WARNING: %s overrides %s --set-filename--for-your-eyes-only_CONSOLE--no-literal%s not allowed with %s! --textmode%s makes no sense with %s! --set-filesize--require-secmemideas1invalid default preferences h2--detach-sign--symmetric--symmetric --encrypt--store--sign%s does not yet work with %s --multifilerandom_seedsecring.gpgpubring.gpg--store [filename]storing `%s' failed: %s %s: encryption failed: %s --sign [filename]signing failed: %s --sign --encrypt [filename]%s: sign+encrypt failed: %s --sign --symmetric [filename]--clearsign [filename]%s: clearsign failed: %s verify files failed: %s verify signatures failed: %s --decrypt [filename]decrypt_message failed: %s --sign-key user-id--lsign-key user-idlsignsave--edit-key user-id [commands]--gen-key [parameterfile]--gen-keykeyserver send failed: %s keyserver receive failed: %s key export failed: %s keyserver search failed: %s keyserver refresh failed: %s key fetch failed: %s --gen-revoke user-id--desig-revoke user-id--dearmor [file]dearmoring failed: %s --enarmor [file]enarmoring failed: %s --gen-random 0|1|2 [count]--print-md algo [files]invalid hash algorithm `%s' --update-trustdb--list-trust-path --import-ownertrust [file]--card-status--change-pin [no]cfg:group:cfg:version:pubkeycfg:pubkey:ciphercfg:cipher:ciphernamecfg:ciphername:digestcfg:digest:digestnamehashnamecfg:digestname:compresscfg:compress:ccid-reader-idcfg:ccid-reader-id:%s can't open `%s' md5--clearsign@Commands: |[file]|make a signaturemake a detached signatureencrypt dataencrypt-files@decryptdecrypt data (default)decrypt-filesverify a signatureverify-fileslist-keyslist keyslist-public-keyslist-sigslist keys and signaturescheck-sigslist and check key signatureslist keys and fingerprintslist-secret-keyslist secret keysgenerate a new key pairdelete-keysdelete-secret-keyssign a keylsign-keysign a key locallyedit-keysign or edit a keygen-revokedesig-revokeexportexport keyssend-keysexport keys to a key serverrecv-keysimport keys from a key serversearch-keysrefresh-keysfetch-keysexport-secret-keysexport-secret-subkeysimport/merge keysfast-importprint the card statuscard-editchange data on a cardchange-pinchange a card's PINlist-configgpgconf-listgpgconf-testlist-packetsimport-ownertrustupdate the trust databasefix-trustdbdearmordearmourenarmorenarmourprint-mdgen-primegen-random@ Options: create ascii armored output|NAME|encrypt for NAMEremote-userdefault-recipient-selfno-default-recipienttemp-directoryexec-pathno-encrypt-tolocal-userbzip2-compress-levelbzip2-decompress-lowmemuse canonical text modeno-textmodeno-expertdefault-sig-expireno-ask-sig-expiredefault-cert-expireno-ask-cert-expiredefault-cert-levelmin-cert-levelno-ask-cert-leveluse as output filemax-outputquietno-ttyno-force-v3-sigsno-force-v4-certsno-force-mdcno-disable-mdcdo not make any changesinteractiveprompt before overwritingno-use-agentgpg-agent-infoyesnoprimary-keyringsecret-keyringdefault-keykeyserver-optionsimport-optionsexport-optionslist-optionsverify-optionsdisplay-charsetdebugdebug-allstatus-fdstatus-fileattribute-fdattribute-fileno-sk-commentscompletes-neededmarginals-neededmax-cert-depthtrusted-keyload-extensionno-pgp2no-pgp6no-pgp7no-pgp8rfc4880use strict OpenPGP behaviorno-rfc2440-texts2k-modes2k-digest-algos2k-cipher-algos2k-countsimple-sk-checksumcert-digest-algocompress-algocompression-algono-throw-keyidno-throw-keyidsphoto-viewerset-notationnotation-datasig-notationcert-notationprint-mdslist-trustdbpassphrase-fdpassphrase-filepassphrase-repeatcommand-fdcommand-filequick-randomno-verbosetrustdb-nameno-secmem-warningno-require-secmemno-permission-warningno-mdc-warningno-armorno-armourno-default-keyringno-greetingno-optionshomedirno-batchwith-colonswith-key-datalist-keylist-sigcheck-sigskip-verifycompress-keyscompress-sigsdefault-cert-check-levelalways-trusttrust-modelrun-as-shm-coprocessno-for-your-eyes-onlyset-policy-urlsig-policy-urlcert-policy-urlsig-keyserver-urlno-emit-versionno-versionnot-dash-escapedno-escape-from-lineslock-oncelock-multiplelock-neverlogger-fdlogger-fileno-use-embedded-filenameno-utf8-stringswith-fingerprintdisable-cipher-algodisable-pubkey-algono-allow-non-selfsigned-uidno-allow-freeform-uidfast-list-modefixed-list-modelist-onlyignore-time-conflictignore-valid-fromignore-crc-errorignore-mdc-errorshow-session-keyoverride-session-keyno-random-seed-fileno-sig-cacheno-sig-create-checkno-auto-check-trustdballow-secret-key-importtry-all-secretsenable-special-filenamesno-expensive-trust-checksdelete-secret-and-public-keyspreserve-permissionsdefault-preference-listdefault-keyserver-urlpersonal-cipher-preferencespersonal-digest-preferencespersonal-compress-preferencespersonal-cipher-prefspersonal-digest-prefspersonal-compress-prefsdisplayttynamettytypelc-ctypelc-messagesungroupno-groupsno-strictno-mangle-dos-filenamesenable-progress-filterkeyid-formatexit-on-status-write-errorlimit-card-insert-triesreader-portctapi-driverpcsc-driverdisable-cciddebug-ccid-driverallow-multisig-verificationenable-dsa2disable-dsa2no-allow-multiple-messagessign-withrequire-cross-certificationno-require-backsigsno-auto-key-locateshow-std-notationsshow-standard-notationsshow-user-notationsshow-keyserver-urlsshow-uid-validityshow-unusable-uidsshow-primary-uid-onlypka-lookupspka-trust-increaseshow-unusable-subkeysshow-sig-expireshow-sig-subpacketsthe given certification policy URL is invalid the given signature policy URL is invalid WARNING: unsafe ownership on configuration file `%s' WARNING: unsafe ownership on extension `%s' WARNING: unsafe permissions on homedir `%s' WARNING: unsafe permissions on configuration file `%s' WARNING: unsafe permissions on extension `%s' WARNING: unsafe enclosing directory ownership on homedir `%s' WARNING: unsafe enclosing directory ownership on configuration file `%s' WARNING: unsafe enclosing directory ownership on extension `%s' WARNING: unsafe enclosing directory permissions on homedir `%s' WARNING: unsafe enclosing directory permissions on configuration file `%s' WARNING: unsafe enclosing directory permissions on extension `%s' WARNING: unsafe ownership on homedir `%s' NOTE: old default options file `%s' ignored Please report bugs to . Usage: gpg [options] [files] (-h for help)Syntax: gpg [options] [files] sign, check, encrypt or decrypt default operation depends on the input data gpg: WARNING: standard input reopened gpg: WARNING: standard output reopened gpg: WARNING: standard error reopened gpg: fatal: unable to reopen standard input, output, or error NOTE: no default option file `%s' NOTE: %s is not for normal use! cipher extension `%s' not loaded due to unsafe permissions the given preferred keyserver URL is invalid `%s' is not a valid signature expiration `%s' is not a valid character set could not parse keyserver URL %s:%d: invalid keyserver options %s:%d: invalid import options %s:%d: invalid export options %s:%d: invalid verify options unable to set exec-path to %s no = sign found in group definition `%s' %s:%d: invalid auto-key-locate list WARNING: program may create a core file! will not run with insecure memory due to %s you can only make detached or clear signatures while in --pgp2 mode you can't sign and encrypt at the same time while in --pgp2 mode you must use files (and not a pipe) when working with --pgp2 enabled. encrypting a message in --pgp2 mode requires the IDEA cipher selected cipher algorithm is invalid selected digest algorithm is invalid selected compression algorithm is invalid selected certification digest algorithm is invalid completes-needed must be greater than 0 marginals-needed must be greater than 1 max-cert-depth must be in the range from 1 to 255 invalid default-cert-level; must be 0, 1, 2, or 3 invalid min-cert-level; must be 1, 2, or 3 NOTE: simple S2K mode (0) is strongly discouraged invalid S2K mode; must be 0, 1 or 3 invalid personal cipher preferences invalid personal digest preferences invalid personal compress preferences you may not use cipher algorithm `%s' while in %s mode you may not use digest algorithm `%s' while in %s mode you may not use compression algorithm `%s' while in %s mode failed to initialize the TrustDB: %s WARNING: recipients (-r) given without using public key encryption symmetric encryption of `%s' failed: %s --symmetric --encrypt [filename]you cannot use --symmetric --encrypt with --s2k-mode 0 you cannot use --symmetric --encrypt while in %s mode --symmetric --sign --encrypt [filename]you cannot use --symmetric --sign --encrypt with --s2k-mode 0 you cannot use --symmetric --sign --encrypt while in %s mode %s: symmetric+sign+encrypt failed: %s %s: sign+symmetric failed: %s -k[v][v][v][c] [user-id] [keyring]--gen-prime mode bits [qbits] unknown configuration item `%s' Go ahead and type your message ... processing message failed: %s |[file]|make a clear text signatureencryption only with symmetric cipherremove keys from the public keyringremove keys from the secret keyringgenerate a revocation certificatesearch for keys on a key serverupdate all keys from a keyserver|algo [files]|print message digestsuse this user-id to sign or decrypt|N|set compress level N (0 disables)generate PGP 2.x compatible messages@ (See the man page for a complete listing of all commands and options) @ Examples: -se -r Bob [file] sign and encrypt for user Bob --clearsign [file] make a clear text signature --detach-sign [file] make a detached signature --list-keys [names] show keys --fingerprint [names] show fingerprints no-require-cross-certificationdisplay photo IDs during signature verificationshow policy URLs during signature verificationshow all notations during signature verificationshow IETF standard notations during signature verificationshow user-supplied notations during signature verificationshow preferred keyserver URLs during signature verificationshow user ID validity during signature verificationshow revoked and expired user IDs in signature verificationshow only the primary user ID in signature verificationvalidate signatures with PKA dataelevate the trust of signatures with valid PKA datadisplay photo IDs during key listingsshow policy URLs during signature listingsshow all notations during signature listingsshow IETF standard notations during signature listingsshow user-supplied notations during signature listingsshow preferred keyserver URLs during signature listingsshow user ID validity during key listingsshow revoked and expired user IDs in key listingsshow revoked and expired subkeys in key listingsshow the keyring name in key listingsshow expiration dates during signature listings.`.........................0x..`@*******************fE*******}nF)********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************O****m\\\\;**\\x\\\\\\&\v`J4b7q[E/ K<~oP#tN!~`QB1 *tteVG8)udSD0k[F9,5$(K gB3aP@1"^Om[j|cr oI|m^B&iZK<-whW %4p_N=,CdI:+|p?main~6D. t # \5@H^j(check_permissionscheck_permissions~\6. P# 5@}Dparse_subpacket_listWARNING: invalid notation data found a notation name must have only printable characters or spaces, and end with an '=' a user notation name must contain the '@' character a notation name must not contain more than one '@' character a notation value must not use any control characters delete_subpkt: buffer shorter than subpacket invalid packet type in calc_packet_length()do_plaintext(): wrote %lu bytes but expected %lu bytes ((sk->skey[npkey]) && (mpi_get_flags (sk->skey[npkey])&4))((sk->skey[i]) && (mpi_get_flags (sk->skey[i])&4))invalid packet type in build_packet() not human readable../../g10/build-packet.cunused <= area->lencan't cope with hdrlen yet build_packet() type=%d GNUenc->version == 4do_symkey_enc: s2k=%d ed->mdc_method@>@@h@>>>>>>>>>>>>X@>>>H@>8@HH HpH HPH H H H HH$HOMXMLJIJIhI$HPIHHI$HHHI$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$HHbuild_sig_subpktdelete_sig_subpktcalc_packet_lengthbuild_packetdo_secret_keydo_symkey_encdo_encrypted_mdc../../g10/compress.czlib deflate problem: %s zlib deflate problem: rc=%d deflate: iobuf_write failed 1.2.3.3out of coreunknown errorinvalid lib versionzlib problem: %s zlib inflate problem: %s zlib inflate problem: rc=%d compress_filterenter deflate: avail_in=%u, avail_out=%u, flush=%d leave deflate: avail_in=%u, avail_out=%u, n=%u, zrc=%d begin inflate: avail_in=%u, avail_out=%u, inbuf=%u enter inflate: avail_in=%u, avail_out=%u leave inflate: avail_in=%u, avail_out=%u, zrc=%d do_uncompress: returning %u bytes build_packet(PKT_COMPRESSED) failed invalid compression level; using default level push_compress_filter2compress_filterenter bzCompress: avail_in=%u, avail_out=%u, flush=%d bz2lib deflate problem: rc=%d leave bzCompress: avail_in=%u, avail_out=%u, n=%u, zrc=%d bzCompress: iobuf_write failed begin bzDecompress: avail_in=%u, avail_out=%u, inbuf=%u enter bzDecompress: avail_in=%u, avail_out=%u leave bzDecompress: avail_in=%u, avail_out=%u, zrc=%d bz2lib inflate problem: rc=%d bz2lib problem: %d unexpected EOF in bz2lib ../../g10/compress-bz2.ccompress_filter_bz2../../g10/free-packet.cuid->ref > 0free_packet() type=%d 3opoo3oooooo3oo3ooo3o3o3oo3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3o3oxofree_user_idcopy_public_keynodefaultlocalldappka[User ID not found]../../g10/getkey.c01234567890abcdefABCDEF0123456789abcdefABCDEF checking subkey %08lX subkey not valid subkey has been revoked subkey has expired subkey not yet valid subkey looks fine primary key not valid primary key has expired primary key may be used using key %08lX pub == pubblockkeydb_search failed: %s !ret_kdbhdDNS CERTPKALDAPfpr_len<=20%08lX%08lX %.*s%08lX%08lX [?]%s %.*s%s [?]a->pkt->pkttype == PKT_SECRET_KEY || a->pkt->pkttype == PKT_SECRET_SUBKEYa->pkt->pkttype == PKT_PUBLIC_KEY || a->pkt->pkttype == PKT_PUBLIC_SUBKEYcache_public_key: already in cache too many entries in pk cache - disabled keydb_get_keyblock failed: %s keyblock->pkt->pkttype == PKT_PUBLIC_KEY || keyblock->pkt->pkttype == PKT_PUBLIC_SUBKEYexpected public key but found secret key - must stop Invalid key %s made valid by --allow-non-selfsigned-uid key %s: secret key without public key - skipped pubblock->pkt->pkttype == PKT_PUBLIC_KEYsecblock->pkt->pkttype == PKT_SECRET_KEYno secret subkey for public subkey %s - ignoring keyblock->pkt->pkttype == PKT_PUBLIC_KEYk->pkt->pkttype == PKT_PUBLIC_KEY || k->pkt->pkttype == PKT_PUBLIC_SUBKEYk->pkt->pkttype == PKT_USER_IDfinish_lookup: checking key %08lX (%s)(req_usage=%x) usage does not match: want=%x have=%x no suitable subkeys found - trying primary primary key has been revoked primary key usage does not match: want=%x have=%x no suitable key found - giving up using subkey %s instead of primary key %s cache_user_id: already in cache automatically retrieved `%s' via %s auto-key-locate found fingerprint %s error checking usability status of %s ~|||||||||||||||||||||||||||||||||| ~||||||N~|||||||||||||||}|v~:~||b~Pmerge_selfsigsmerge_selfsigs_mainmerge_selfsigs_subkeylookuppremerge_public_with_secretfinish_lookupcache_user_idmerge_public_with_secretmerge_public_with_secretsk_from_blockkey_bynamepk_from_blockget_pubkey_byfprint_fastget_pubkey_bynameget_pubkey_fast../../g10/keydb.cactive_handles > 0used_resources <= 40gnupg-ring:can't allocate lock for `%s' can't lock `%s' keyring `%s' created keyblock resource `%s': %s failed to rebuild keyring cache: %s invalid key resource URL `%s' unknown type of key resource `%s' error creating keyring `%s': %s keydb_search2keydb_locate_writablekeydb_releasekeydb_newbuild_packet(%d) failed: %s %s is the unchanged one %s is the new one ../../g10/keyring.c!hd->current.iobuf%s: keyring created %s: close failed: %s %s: copy to `%s' failed: %s n_packetscan't seek `%s' can't unlock `%s' error closing `%s': %s caching keyring `%s' - deletedkeyring_search failed: %s gpg --rebuild-keydb-cacheswriting sigcache packet failed renaming `%s' to `%s' failed: %s WARNING: unable to restore permissions to `%s': %sWARNING: 2 files with confidential information exists. Please fix this possible security flaw resource && !resource->secret == !secretword search mode does not yet work %s: skipping %u packets failed: %s keyring_get_keyblock: read error: %s skipped compressed packet in keyring re-reading keyblock failed: %s keyring_get_keyblock failed: %s unexpected keyblock found (pkttype=%d)%s %lu keys cached so far (%lu signatures) %lu keys cached (%lu signatures) Hint: backup your keys and try running `%s' =====8qqIu@@@@@@ ookeyring_searchkeyring_searchprepare_search0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZABCDEFGHIJKLMNOPQRSTUVWXYZcompare_namekeyring_search_resetkeyring_delete_keyblockdo_copykeyring_update_keyblockkeyring_releasekeyring_newkeyring_register_filenamecan't encode a %d bit MD into a %d bits frame DSA requires the hash length to be a multiple of 8 bits DSA key %s uses an unsafe (%u bit) hash DSA key %s requires a %u bit or larger hash can't encode a %d bit key in a %d bits frame cannot avoid weak key for symmetric cipher; tried %d times! ../../g10/seskey.ci > 1n == nframepk || ski > 0weak key created - retrying encode_md_valuepkcs1_encode_mdencode_session_keynode %p %02x/%02x type=%s "" %c%c%c%c ctrl=%d len=%u emptypublic-enconepass-sigsecret-keypublic-keysecret-subkeyplaintextpublic-subkeygpg-control class=%02x keyid=%08lX ts=%lu keyid=%08lX a=%d u=%d %c%c%c%c  A    "+A s AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAtA ../../g10/mainproc.cpublic key is %s %s encrypted session key "%s" encrypted with %s key, ID %s encrypted with 1 passphrase assuming %s encrypted data decryption okay session key: `%s' original file name='%.*s' verify2handle plaintext failed: %s uncompressing failed: %s Do we really need this here?pub:%u:%d:%08lX%08lX:%s:%s::rtv:1:%u: %s %4u%c/%s %s%s[revoked]uat%s:::::::::uid%*srtv:2:%u: [revoked: %sexpires: %sssbsec%s::%u:%d:%08lX%08lX:%s:%s:::%s %4u%c/%s %s rev::%d:%08lX%08lX:%s:%s:%c %s %s [%s] [selfsig][keybind]:%02x%c:!sig->pka_infopka-address@gnupg.orgSignature made %s Key available at: %08lX%08lX [uncertain] BAD signature from "%s"Expired signature from "%s"Good signature from "%s" [%s] [uncertain] aka "%s" %s %lu %lu %d 0 %d %d %02X Signature expired %s Signature expires %s binary%08lX%08lX %d %d %02x %lu %dCan't check signature: %s can't hash datafile: %s not a detached signature !c->list!c->pipemode.opc->pipemode.op == 'B'subkey w/o mainkey orphaned user ID ring trust w/o key no signature found public key encrypted data: good DEK invalid symkey encrypted packet encrypted with unknown algorithm %d passphrase generated with unknown digest algorithm %d weird size for an encrypted session key (%d) encrypted with %u-bit %s key, ID %s, created %s public key decryption failed: %s encrypted with %lu passphrases IDEA cipher unavailable, optimistically attempting to use %s instead WARNING: message was not integrity protected WARNING: encrypted message has been manipulated! NOTE: sender requested "for-your-eyes-only" invalid control packet CTRLPKT_CLEARSIGN_START WARNING: multiple plaintexts seen proc_pkt.plaintext 89_BAD_DATAnode->pkt->pkttype == PKT_SIGNATUREstandalone revocation - use "gpg --import" to apply invalid root packet for sigclass %02x ERROR: unexpected packet type %dinvalid node with packet of type %d signature verification suppressed number of one-pass packets does not match number of signature packets can't handle this ambiguous signature data using %s key %s Signature made %s using %s key ID %s %s signature, digest algorithm %s cleartext signature without data WARNING: multiple signatures detected. Only the first will be checked. standalone signature of class 0x%02x old style (PGP 2.x) signature invalid root packet detected in proc_tree() invalid pipemode control packet length invalid pipemode control packet code ~@(A~@A~@~@~@~@@@~@~@~@~@~@~@~@~@@~@`BPB`B@B`B`B~@@`B~@(B~@`B~@~@~@~@`B~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@B~@(APBA@B`B`B~@@@~@(B~@`B~@~@~@~@@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@B~@(APBA@BBBB@@~@(BB~BB~@~@~@@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@Badd_signaturesymkey_decrypt_seskeyadd_gpg_controlprint_useriddo_check_sigcheck_sig_and_printpka_uri_from_siginvalid radix64 character %02X skipped Version: GnuPG v1.4.10 (GNU/Linux)invalid armor: line longer than %d characters quoted printable character in armor - probably a buggy MTA has been used CRC error; %06lX - %06lX -----BEGIN PGP SIGNATURE-----armor: %s invalid armor header: Hash:RIPEMD160SHA1MD5SHA224SHA256SHA384SHA512NotDashEscaped:invalid clearsig header VersionMessageIDHashCharsetunknown armor header: unexpected armor: invalid dash escaped line: = premature eof (no CRC) malformed CRC armor-filter: control: %d ../../g10/armor.cnested clear text signatures afx->what=%dComment: \n\r\vno valid OpenPGP data found. armor_filterBEGIN PGP MESSAGEBEGIN PGP PUBLIC KEY BLOCKBEGIN PGP SIGNATUREBEGIN PGP SIGNED MESSAGEBEGIN PGP ARMORED FILEBEGIN PGP PRIVATE KEY BLOCKBEGIN PGP SECRET KEY BLOCKEND PGP MESSAGEEND PGP PUBLIC KEY BLOCKEND PGP SIGNATUREEND dummyEND PGP ARMORED FILEEND PGP PRIVATE KEY BLOCKEND PGP SECRET KEY BLOCKFEHG F0GFFpGGG FPF`G FHHHHHH FHHHH F F F FH F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F FHhnxnxnxnxnxnxnhnxnxnxnxnhnhnhnhnxnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnhnxn (<Ularmor_filtermd_filterFrom ../../g10/textfilter.csize > 10text_filterinput line longer than %d characters can't handle text lines longer than %d characters standardstdin%.20s ? %lu %luprogress_filterKxxbxxxKxKxKxKxKxKxKxKxKxKxKxKxbxpxKxKxXxPP0 HHH##############$ $???/usr/lib//gnupgGNUPGHOME~/.gnupgPATH..ZIPUncompressedZLIBBZIP2GnuPG 1.x%s%*s%s no-ambiguous option `%s' unknown option `%s' uncompressed|noneuncompressedzipzlibbzip2z0z1z2z3please use "%s%s" instead SIG-COUNTERcan't disable core dumps: %s --gnupg--openpgp--rfc2440--rfc1991--pgp2--pgp6--pgp7--pgp8GnuPGOpenPGPOpenPGP (older)old PGPPGP 2.xPGP 6.xPGP 7.xPGP 8.x01234567890_-.abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZthis message may not be usable by %s WARNING: "%s" is a deprecated command - do not use it NOTE: This feature is not available in %s please see %s for more information http://www.gnupg.org/faq/features-not-in-gnupg-1.htmlthe IDEA cipher plugin is not present http://www.gnupg.org/faq/why-not-idea.html%s:%d: deprecated option "%s" WARNING: "%s" is a deprecated option WARNING: digest algorithm %s is deprecated http://www.gnupg.org/faq/weak-digest-algos.htmlWARNING: using experimental digest algorithm %s WARNING: using experimental cipher algorithm %s WARNING: using experimental public key algorithm %s WARNING: Elgamal sign+encrypt keys are deprecated directory `%s' created .pgp.sig.asc.sign%s: unknown suffix assuming signed data in `%s' Enter new filename%s [%s]: openfile.askoutnameFile `%s' exists. Overwrite? (y/N) openfile.overwrite.okay[stdout]writing to stdout writing to `%s' can't create directory `%s': %s new configuration file `%s' created WARNING: options in `%s' are not yet active during this run %04d-%02d-%02dnever 0x%08lX0x%08lX%08lX../../g10/keyid.c?v3 fpr?len <= 20Oops: keyid_from_fingerprint: no pubkey fingerprint_from_skfingerprint_from_pkkeystr_from_desckeystrkeystrlenRrs????????????gD??G8888880888б888H8888x88888j$3 TҼ %5w[%m8w^wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwdmake_attribute_uidnameparseparse_symkeyenc../../g10/parse-packet.cmax_namelen > 70[%d attributes of size %lu][%.20s image of size %lu][invalid image] %4d: EOF %02xhashed critical %s%ssubpkt %d len %u (signer's user IDsig created %ssig expires after %ssig does not expirenot %sexportable[invalid trust subpacket][invalid regexp subpacket]regular expression: "%s"%srevocablekey expires after %skey does not expirepref-sym-algos:revocation key: [too short]c=%02x a=%d f=issuer key ID %08lX%08lX[error][not human readable]pref-hash-algos:pref-zip-algos:key server preferences:preferred key server: key flags:revocation reason 0x%02x (Big Brother's key (ignored): features:signature: primary user IDpacket(%d) too short packet(%d) too large packet with S2K %d too short !pktlen, seskey %d bits salt , count %lu (%lu) unsupported algorithm %d data: :packet 63: length %lu - gpg control packet- private (rest length %lu) :rfc1991 comment packet: "\x%02xpublicsecretpublic subsecret sub unknown algorithm %d skey[%d]: unknown S2K %d simple S2K salted S2K iter+salt S2K gnu-dummy S2K gnu-divert-to-card S2KGNU unknown %sS2K %d simple checksum, SHA1 protection,, algo: %d,%s hash: %d, salt: protect count: %lu serial-number: protect IV: dummydata encrypted stuff follows mpi too small mpi too large (%u bits) skey[%d]: [encrypted] checksum: %04hx pkey[%d]: packet shorter tham mpi !pkt->pkt.generic[don't know]%s: 1st length byte missing %s: 2nd length byte missing %s: 4 byte length invalid %s: garbled packet detected copy_packet: compressed! (new_ctb):user ID packet: ":attribute packet: %s GnuPG OpenPGP draft :%scomment packet: ":trust packet: empty packet(%d) too short (%lu) ", raw data: unknown length %lu bytes :compressed packet: algo=%d mdc_method: %d :mdc packet: length=%lu :marker packet: PGP invalid marker packet dump:skipsomecopysearchparse[bad attribute packet of size %lu][unknown attribute of size %lu]buffer shorter than attribute subpacket can't handle public key algorithm %d preferred-email-encoding@pgp.comsubpacket of type %d has critical bit set subpkt %d len %u (additional recipient request) WARNING: PGP versions > 5.0 and < 6.5.8 will automagically encrypt to this key and thereby reveal the plaintext to the owner of this ARR key. Detailed info follows: too short: buffer is only %u) trust signature of depth %d, value %dv%d, class 0x%02X, algo %d, digest algo %dexperimental / private subpacketsubpacket of type %d too short buffer shorter than subpacket packet(%d) with unknown version %d WARNING: potentially insecure symmetrically encrypted session key :symkey enc packet: version %d, cipher %d, s2k %d, hash %d:pubkey enc packet: version %d, algo %d, keyid %08lX%08lX :%s key packet: version %d, algo %d, created %lu, expires %lu protect algo: %d (hash algo: %d) signature packet: hashed data too long premature eof while reading hashed signature data signature packet: unhashed data too long premature eof while reading unhashed signature data signature packet without timestamp signature packet without keyid :signature packet: algo %d, keyid %08lX%08lX version %d, created %lu, md5len %d, sigclass 0x%02x digest algo %d, begin of digest %02x %02x signature packet: too much data %s: invalid packet (ctb=%02x) %s: partial length for invalid packet type %d %s: indeterminate length for invalid packet type %d parse_packet(iob=%d): type=%d length=%lu%s (%s.%s.%d) onepass_sig with unknown version %d :onepass_sig packet: keyid %08lX%08lX version %d, sigclass 0x%02x, digest %d, pubkey %d, last=%d :trust packet: flag=%02x sigcache=%02x :literal data packet: mode %c (%X), created %lu, name="encrypted_mdc packet with unknown version %d :encrypted data packet: length: %lu :encrypted data packet: length: unknown mdc_packet with invalid encoding :unknown packet: type %2d, length %lu [GNUPG:] %s [GNUPG:] ../../g10/status.c%.20s X 100 100%.20s %c 0 0primegenpk_dsapk_elgENTERLEAVEABORTGOODSIGBADSIGERRSIGBADARMORRSA_OR_IDEAKEYEXPIREDKEYREVOKEDTRUST_UNDEFINEDTRUST_NEVERTRUST_MARGINALTRUST_FULLYTRUST_ULTIMATESHM_INFOSHM_GETSHM_GET_BOOLSHM_GET_HIDDENNEED_PASSPHRASEVALIDSIGSIG_IDENC_TONODATABAD_PASSPHRASENO_PUBKEYNO_SECKEYNEED_PASSPHRASE_SYMDECRYPTION_FAILEDDECRYPTION_OKAYMISSING_PASSPHRASEGOOD_PASSPHRASEGOODMDCBADMDCERRMDCIMPORTEDIMPORT_RESFILE_STARTFILE_DONEFILE_ERRORBEGIN_DECRYPTIONEND_DECRYPTIONBEGIN_ENCRYPTIONEND_ENCRYPTIONDELETE_PROBLEMGET_LINEGOT_ITPROGRESSSIG_CREATEDSESSION_KEYNOTATION_NAMENOTATION_DATAPOLICY_URLBEGIN_STREAMEND_STREAMUSERID_HINTUNEXPECTEDINV_RECPNO_RECPALREADY_SIGNEDEXPSIGEXPKEYSIGATTRIBUTEIMPORT_OKIMPORT_CHECKREVKEYSIGCARDCTRLNEWSIGPLAINTEXTPLAINTEXT_LENGTHKEY_NOT_CREATEDNEED_PASSPHRASE_PINSIG_SUBPACKETSC_OP_FAILURESC_OP_SUCCESSBACKUP_KEY_CREATEDPKA_TRUST_BADPKA_TRUST_GOODBEGIN_SIGNING                                  do_shm_get< <<<<&<-<6<B<M<X<h<t<<<<<<<<<<<<<===0=B=R=e=u=}============<><>>'>3>?>M>[>f>s>q?~>>>>>D>>>>>>>>? ??,?@?"N?\?j?}???=client modified shm control block - abort client returns too large data (%u bytes) too much shared memory requested; only 8k are allowed can't get %uk of shared memory: %s locking shared memory %d failed: %s shmctl IPC_STAT of %d failed: %s shmctl IPC_SET of %d failed: %s can't attach %uk shared memory: %s mapped %uk shared memory at %p, id=%d shmctl IPC_RMDID of %d failed: %s pv=1 pid=%d shmid=%d sz=%u lz=%ucan't open fd %d for status output: %s SIGEXPIRED deprecated-use-keyexpired-instead%X %lu error creating `%s': %s wbexceeded --max-output limit Error writing to `%s': %s Error closing `%s': %s no signed data can't open signed data `%s' Detached signature. detached_signature.filenamereading stdin ... ../../g10/plaintext.cfpdata not saved; use option "--output" to save it clearsig encountered while not expected Problem reading source (%u bytes remaining) Please enter name of data file: No such file, try again or hit enter to quit. ask_for_detached_datafilepublic key %s is %lu second newer than the signature public key %s is %lu seconds newer than the signature key %s was created %lu second in the future (time warp or clock problem) key %s was created %lu seconds in the future (time warp or clock problem) NOTE: signature key %s expired %s assuming bad signature from key %s due to an unknown critical bit WARNING: signature digest conflict in message WARNING: signing subkey %s is not cross-certified http://www.gnupg.org/faq/subkey-cross-certify.htmlWARNING: signing subkey %s has an invalid cross-certification (sig->keyid[0]!=pk->keyid[0]) || (sig->keyid[0]!=pk->keyid[1])root->pkt->pkttype == PKT_PUBLIC_KEYkey %s: no subkey for subkey revocation signature key %s: no subkey for subkey binding signature unode->pkt->pkttype == PKT_USER_IDkey %s: no user ID for key signature packet of class %02x %s %s %lu../../g10/sig-check.c((sig)->sig_class == 0x20)check_key_signature2hash_uid_nodecheck_revocation_keyscheck_revocation_keys1 bad signature %d bad signatures Primary key fingerprint: Subkey fingerprint: Key fingerprint =fpr::::::::: %02X%02Xpkd:%d:%u:spk:%d:%u:%u: Card serial no. =../../g10/keylist.cprimary0rvk:::%d:::::::%02x%s: %lu %u %u %u %lu %lu %uopt.show_subpacketsCritical signature policy: Signature policy: Critical signature notation: Signature notation: Preferred keyserver: %d %u %u Oops; key lost! sec%c %4u%c/%s %sexpired: %spub %4u%c/%s %suid%*s%s sub %4u%c/%s %sssb%c %4u%c/%s %spub:%s:r::::%s:e::::%s:%c::::sub::%u:%d:%08lX%08lX:%s:%s:::::[revoked]:[key binding]:[subkey revoked]:sig::::::::::%02x%c: %s%c %4u%c/%s created: %s card-no: pub %4u%c/%s %s %s sec %4u%c/%s %s %s keydb_search_next failed: %s Keyringerror reading key: %s tru::%d:%lu:%lu:%d:%d:%dcan't open fd %d for attribute output: %s 1 signature not checked due to a missing key %d signatures not checked due to missing keys 1 signature not checked due to an error %d signatures not checked due to errors primary key is not really primary! Critical preferred keyserver: sig [unexpected signature class 0x%02x] sec::%u:%d:%08lX%08lX:%s:%s:::ssb::%u:%d:%08lX%08lX:%s:%s:::::keydb_search_first failed: %s v$do_reorder_keyblockprint_revokersdump_attribsprint_subpackets_colon../../g10/signal.cwhich == 1 caught ... exiting pause_on_sigusrsending command `%s' to agent failed: %s pin_cb called without proper PIN info hack PIN not correctly repeated; try againerror: LF detected in status line - not sending invalid serial number in keyring detected Please remove the current card and insert the one with serial number: %.*s Hit return when ready or enter 'c' to cancel: error parsing received key data unknown parameter name in received key data Please insert the card and hit return or enter 'c' to cancel: SCD WRITEKEY --force OPENPGP.%dAPPTYPEDISP-NAMEDISP-LANGDISP-SEXPUBKEY-URLLOGIN-DATACHV-STATUSEXTCAPkiaacKEY-FPRKEY-TIMECA-FPRPRIVATE-DO-1234../../g10/cardglue.cno >= 0 && no <= 3KEY-ATTR%d %d %dOPENPGP 3 OPENPGP 1 OPENPGP 3OPENPGP 1Enter New Admin PIN: Enter New PIN: Enter Admin PIN: Enter PIN: passphrase.adminpin.new.askpassphrase.pin.new.askpassphrase.pin.askpassphrase.adminpin.askRepeat this PIN: passphrase.pin.repeat%s%s%s1 %.32scardctrl.change_card.okayKEY-DATAKEY-CREATED-ATSCD SERIALNO openpgpselecting openpgp failed: %s card reader not available cardctrl.insert_card.okay --resetSCD PASSWD%s %dSCD PASSWD--force SCD GENKEY %s%dSCD GENKEYSCD WRITEKEYOPENPGP.%dSCD GETATTRSCD LEARN --forceSCD LEARNSCD CHECKPINSCD SETATTRSCD SETDATASCD PKDECRYPT %sSCD PKDECRYPT--hash=rmd160 SCD PKSIGN %s%sSCD PKSIGNlearn_status_cbgcry_md_hash_bufferCHV-STATUS-1error reading `%s': %s CA fingerprint: cardedit.change_cafprCA-FPR-1CA-FPR-2CA-FPR-3error setting cafpr: %s ../../g10/card-util.cnr >= 1 && nr <= 4Private DO data: cardedit.change_private_doerror setting private DO: %s OPENPGP.3error writing `%s': %s keyno >= 0 && keyno <= 3Replace existing key? (y/N) cardedit.genkeys.replace_keyerror checking the PIN: %s cardedit.genkeys.sizerounded up to %u bits RSA--force %d 1 %uD27600012401not an OpenPGP cardcardedit.genkeys.backup_encReplace existing keys? (y/N) cardedit.genkeys.replace_keys12345678123456 [none]Signature key ....:Encryption key....:Authentication key: (1) Signature key (2) Encryption key (3) Authentication key Your selection? cardedit.genkeys.storekeytypeInvalid selection. cardedit.genkeys.subkeytype[not set]OpenPGP card no. %s detected can't do this in batch mode Error changing the PIN: %s PIN changed. cardutil.change_pin.menuError unblocking the PIN: %s Reset Code set. Name of cardholder: <<AID::: AID:%s:Application ID ...: %s NKSnetkey-card: this is a NetKey card DINSIGdinsig-card: P15pkcs15-card: GELDKARTEgeldkarte-card: unknown: not an OpenPGP card openpgp-card: version:%.4s: PrismPPC Card SystemsOpenFortressWewid ABZeitControlMagratheatest cardunmanaged S/N rangevendor:%04x:%s: serial:%.8s: lang:sex:%c: url:login:forcepin:%d::: keyattr:%d:%d:%u: maxpinlen:%d:%d:%d: pinretry:%d:%d:%d: sigcount:%lu::: private_do:%d:cafpr:fprtime:%lu:%lu:%lu: Manufacturer .....: %s Serial number ....: %.8s Language prefs ...: femaleunspecifiedSex ..............: %s URL of public key : Login data .......: Private DO 1 .....: Private DO 2 .....: Private DO 3 .....: Private DO 4 .....: CA fingerprint %d .:not forcedSignature PIN ....: %s Key attributes ...: %u%cMax. PIN lengths .: %d %d %d PIN retry counter : %d %d %d Signature counter : %lu created ....: %s General key info..: [none] Command> cardedit.promptAdmin-only command %-10s %s off[CHV3]Admin commands are allowed Cardholder's surname: keygen.smartcard.surnameCardholder's given name: keygen.smartcard.givennameerror setting Name: %s URL to retrieve public key: cardedit.change_urlerror setting URL: %s Login data (account name): cardedit.change_loginerror setting login data: %s Language preferences: cardedit.change_langerror setting lang: %s cardedit.change_sexError: invalid response. 9error setting sex: %s usage: writecert 3 < FILE usage: readcert 3 > FILE quit this menuadminshow admin commandsshow this helplist all available datachange card holder's namechange URL to retrieve keyfetchchange the login namechange card holder's sexchange a CA fingerprintforcesiggenerategenerate new keysunblockprivatedoreadcertwritecerterror setting forced signature PIN flag: %s Error: Only plain ASCII is currently allowed. Error: The "<" character may not be used. Error: Double spaces are not allowed. error allocating enough memory: %s Error: invalid formatted fingerprint. Error: Private DO too long (limit is %d characters). usage error: redirectrion to file required error reading certificate from card: %s WARNING: such a key has already been stored on the card! error clearing forced signature PIN flag: %s What keysize do you want for the Signature key? (%u) What keysize do you want for the Encryption key? (%u) What keysize do you want for the Authentication key? (%u) %s keysizes must be in the range %u-%u The card will now be re-configured to generate a key of %u bits NOTE: There is no guarantee that the card supports the requested size. If the key generation does not succeed, please check the documentation of your card to see what sizes are allowed. error changing size of key %d to %u bits: %s key operation not possible: %s error getting current key info: %s Make off-card backup of encryption key? (Y/n) NOTE: keys are already stored on the card! Please note that the factory settings of the PINs are PIN = `%s' Admin PIN = `%s' You should change them using the command --change-pin node->pkt->pkttype == PKT_SECRET_KEY || node->pkt->pkttype == PKT_SECRET_SUBKEYThe card does not support the import of keys You may only store a 1024 bit RSA key on the card Please select where to store the key: Key does not match the card's capability. unknown key protection algorithm secret parts of key are not available secret key already stored on a card error writing key to card: %s Please select the type of key to generate: OpenPGP card not available: %s This command is only available for version 2 cards Reset Code not or not anymore available 1 - change PIN 2 - unblock PIN 3 - change Admin PIN 4 - set the Reset Code Q - quit PIN unblocked and new PIN set. Error setting the Reset Code: %s error retrieving URL from card: %s error retrieving key fingerprint from card: %s error getting current status: %s error toggling signature PIN flag: %s this is a DINSIG compliant card this is a PKCS#15 compliant card this is a Geldkarte compliant card serial number longer than expected Version ..........: %.1s%c.%.1s%c Admin commands are not allowed Error: Combined name too long (limit is %d characters). Error: URL too long (limit is %d characters). Error: Login data too long (limit is %d characters). Error: invalid length of preference string. Error: invalid characters in preference string. Sex ((M)ale, (F)emale or space): usage: cafpr N 1 <= N <= 3 usage: privatedo N 1 <= N <= 4 error writing certificate to card: %s Invalid command (try "help") fetch the key specified in the card URLchange the language preferencestoggle the signature force PIN flagmenu to change or unblock the PINverify the PIN and list all dataunblock the PIN using a Reset CodeqaO@wkQ/w_1____"_R`___ k^ `^ l-` `U 1`I`0lR`[`Tl0xlm`lu```change_private_docard_store_subkeyreplace_existing_key_pinvalid structure of OpenPGP card (DO 0x93) warning: constructed DO too short warning: historical bytes are too short warning: bad category indicator in historical bytes warning: bad Compact-TLV in historical bytes can't access %s - invalid OpenPGP card? error retrieving CHV status from card %d Admin PIN attempts remaining before card is permanently locked |A|Please enter the Admin PIN%%0A[remaining attempts: %d]error reading application data fingerprint on card does not match requested one existing key will be replaced memory allocation error in send_key_data failed to store the fingerprint: %s failed to store the creation date: %s gc=%d ki=%d fc=%d pd=%d mcl3=%u aac=%d sm=%dPIN callback returned error: %s PIN for CHV%d is too short; minimum length is %d error changing size of key %d to %u bits size of key %d changed to %u bits please wait while key is being generated ... key generation completed (%d seconds) response does not contain the public key data response does not contain the RSA modulus response does not contain the RSA public exponent protected-private-key passed to writekey shadowed-private-key passed to writekey RSA modulus size is %u bits (%u bytes) RSA modulus missing or not of size %d bits RSA public exponent missing or larger than %d bits RSA prime %s missing or not of size %d bits tp - template <= template_sizefailed to use default PIN as %s: %s - disabling further default use ||Please enter the PIN%%0A[sigs done: %lu]verification of Admin PIN is currently prohibited through this command ||Please enter the Reset Code for the cardReset Code is too short; minimum length is %d card does not support digest algorithm %s signatures created so far: %lu Algorithm Attributes SignatureAlgorithm Attributes DecryptionAlgorithm Attributes Authentication../../g10/app-openpgp.cc->tag != tagtag <= 0xffffkeyno >=0 && keyno <= 2error reading DO 0x%02X Key-Attr-%s ..: stdstd+ncrtcrt+nRSA, n=%u, e=%u, fmt=%s OPENPGPAID: Historical Bytes: CHV Status BytesExtended Capability FlagsVersion-2 ......: %s Get-Challenge ..: %s (%u bytes max)Key-Import .....: %s Change-Force-PW1: %s Private-DOs ....: %s Algo-Attr-Change: %s SM-Support .....: %s3DESAES-128 (%s)Max-Cert3-Len ..: %u Max-Cmd-Data ...: %u Max-Rsp-Data ...: %u Cmd-Chaining ...: %s Ext-Lc-Le ......: %s Status Indicator: %02X GnuPG-No-Sync ..: %s GnuPG-Def-PW2 ..: %s DO `%s' not available: %s DO `%s': DO `%s': `%.*s' [%u] card is permanently locked! |A|Please enter the Admin PINkeyno >= 1 && keyno <= 3error reading fingerprint DO keyidx >=0 && keyidx <= 2key already exists generating new key writing new key %d 1 %u %u %dPRIVATE-DO-1PRIVATE-DO-2PRIVATE-DO-3PRIVATE-DO-4verify CHV%d failed: %s generating key failed OPENPGP.1OPENPGP.2protected-private-keyshadowed-private-keyrsacreated-atcreation timestamp missing rsa_e_len <= rsa_e_reqlenrsa_e_len <= 4tp - template == template_lenfailed to store the key: %s chvno == 1 || chvno == 2using default PIN as %s CHV2!*pinvalue||Please enter the PIN|RN|New Reset Code|AN|New Admin PIN|N|New PINerror getting new PIN: %s chvno == 1 || chvno == 3 --force %d %d %ufailed to set `%s': %s datalen <= sizeof dataLogin DataHistorical BytesCardholder Related DataNameLanguage preferencesSexApplication Related DataAIDDiscretionary Data ObjectsExtended Card CapabilitiesCA FingerprintsGeneration timeSecurity Support TemplateDigital Signature CounterPrivate DO 1Private DO 2Private DO 3Private DO 4Cardholder certificateCERT-3SM-KEY-ENCSM-KEY-MAC$AUTHKEYID$DISPSERIALNOv$^{P_8RR_{e{[e|-_e|5_e/|n3|OnL|sP|Gnt|nk|nununvn wn|n|n|z|z||||}!}get_cached_dataparse_algorithm_attributeflush_cache_itemverify_a_chvdo_change_pincompare_fingerprintdo_signdoes_key_existdo_writekeychange_keyattrbuild_privkey_templateadd_tlvR[= 0 && slot < 4invalid PC/SC error codeunknown PC/SC error codeslot %d: ATR=Processor ICC presentICC not presentMemory ICC presentreader slot %d: %s resultlen < bufsize dump: apdulen <= apdu_buffer_sizeinvalid datact errortransmission errormemory allocation errorHTSI errorunknown CT-API error received data: CT_data: raw apdu:CT_initCT_dataCT_closeSCardEstablishContextSCardReleaseContextSCardListReadersSCardGetStatusChangeSCardConnectSCardReconnectSCardDisconnectSCardStatusSCardBeginTransactionSCardEndTransactionSCardTransmitSCardSetTimeoutdetected reader `%s' T0 T1 raw PCSC_data:internal errorinvalid handleinvalid parameterinvalid targetno memorywaited too longinsufficient bufferunknown readersharing violationno smartcardunknown cardcan't disposeproto mismatchnot readysystem cancelledcomm errorinvalid ATRnot transactedreader unavailablePCI too smallreader unsupportedduplicate readercard unsupportedno serviceservice stoppedunsupported featureunsupported cardunresponsive cardunpowered cardreset cardremoved cardinserted cardnew_reader_slot: out of slots pcsc_disconnect failed: %s (0x%lx) reader slot %d: using ccid driver apdu_send_direct(%d) failed: %s response: sw=%04X datalen=%d apdu_send_direct(%d): %d more bytes available apdu_send_direct(%d) for get response failed: %s more: sw=%04X datalen=%d apdu_send_direct(%d) got unexpected status %04X from get response send apdu: c=%02X i=%02X p1=%02X p2=%02X lc=%d le=%d em=%d apdu_send_simple(%d) failed: %s apdu_send_simple(%d): %d more bytes available apdu_send_simple(%d) for get response failed: %s apdu_send_simple(%d) got unexpected status %04X from get response ct_activate_card: can't get status of reader %d: %s ct_activate_card(%d): activation failed: %s ct_activate_card(%d): ATR too long ccid_transceive failed: (0x%lx) apdu_open_reader: failed to open driver: %s apdu_open_reader: invalid CT-API driver open_ct_reader: invalid port %d requested apdu_open_ct_reader failed on port %d: %s apdu_open_reader: failed to open driver `%s': %s apdu_open_reader: invalid PC/SC driver (%d%d%d%d%d%d%d%d%d%d%d%d) pcsc_establish_context failed: %s (0x%lx) error allocating memory for reader list pcsc_list_readers failed: %s (0x%lx) invalid response from pcsc_list_readers error allocating memory for reader name reader slot %d: active protocol:reader slot %d: not connected pcsc_connect failed: %s (0x%lx) pcsc_status failed: %s (0x%lx) %lu ATR returned by pcsc_status is too large pcsc_transmit failed: %s (0x%lx) pcsc_get_status_change failed: %s (0x%lx) apdu_send_directsend_ledisconnect_pcsc_cardconnect_pcsc_card *<KUeyœ‡ч؃ۇ%3FWhsɈԈccid-driver: %s: ccid-driver: [%04lu] 5.0V3.0V1.8V T=0 T=1 (Invalid values detected) 2-wire 3-wire I2C accept eject capture lockecho %02X none %u cols %u lines verification modificationPC_to_RDR_IccPowerOn5.0 V3.0 V1.8 VPC_to_RDR_IccPowerOffPC_to_RDR_GetSlotStatusPC_to_RDR_XfrBlock (continued) (continues+ends) (continues+continued) (DataBlock-expected)PC_to_RDR_GetParametersPC_to_RDR_ResetParametersPC_to_RDR_SetParametersPC_to_RDR_EscapePC_to_RDR_IccClockPC_to_RDR_T0APDUPC_to_RDR_SecurePC_to_RDR_MechanicalPC_to_RDR_AbortPC_to_RDR_SetDataRateUnknown PC_to_RDR command %d:%c%cPIN cancelledCommand not supportedPIN timeoutAutomatic sequence ongoingDeactivated ProtocolProcedure byte conflictICC class not supportedICC protocol not supportedBad checksum in ATRBad TS in ATRParameter error at offset %dError code %02XSlot busyRDR_to_PC_DataBlock (XferBlock-expected)RDR_to_PC_SlotStatus (running) (stopped-L) (stopped-H) (stopped)RDR_to_PC_ParametersRDR_to_PC_EscapeRDR_to_PC_DataRateUnknown RDR_to_PC command [more]request../../g10/ccid-driver.capdulencard_busyr_rid%04X:%04X:X:00000:%04X:%s:0ccid-driver: out of memory !"transport not defined"!"no transport"/dev/cmx0/dev/cmx1ccid-driver: dwLength ..........: %u ccid-driver: bSlot .............: %u ccid-driver: bSeq ..............: %u ccid-driver: bStatus ...........: %u ccid-driver: bError ............: %u ccid-driver: idVendor: %04X idProduct: %04X bcdDevice: %04X ccid-driver: CCID device descriptor is too short ccid-driver: ChipCard Interface Descriptor: ccid-driver: bLength %5u ccid-driver: bDescriptorType %5u ccid-driver: bcdCCID %2x.%02x (Warning: Only accurate for version 1.0)ccid-driver: nMaxSlotIndex %5u ccid-driver: bVoltageSupport %5u %s ccid-driver: dwProtocols %5u ccid-driver: dwDefaultClock %5u ccid-driver: dwMaxiumumClock %5u ccid-driver: bNumClockSupported %5u ccid-driver: dwDataRate %7u bps ccid-driver: dwMaxDataRate %7u bps ccid-driver: bNumDataRatesSupp. %5u ccid-driver: dwMaxIFSD %5u ccid-driver: dwSyncProtocols %08X ccid-driver: dwMechanical %08X ccid-driver: dwFeatures %08X ccid-driver: Auto configuration based on ATR ccid-driver: Auto activation on insert ccid-driver: Auto voltage selection ccid-driver: Auto clock change ccid-driver: Auto baud rate change ccid-driver: Auto parameter negotation made by CCID ccid-driver: Auto PPS made by CCID ccid-driver: WARNING: conflicting negotation features ccid-driver: CCID can set ICC in clock stop mode ccid-driver: NAD value other than 0x00 accepted ccid-driver: Auto IFSD exchange ccid-driver: TPDU level exchange ccid-driver: Short APDU level exchange ccid-driver: Short and extended APDU level exchange ccid-driver: WARNING: conflicting exchange levels ccid-driver: dwMaxCCIDMsgLen %5u ccid-driver: bClassGetResponse ccid-driver: bClassEnvelope ccid-driver: wlcdLayout ccid-driver: bPINSupport %5u ccid-driver: bMaxCCIDBusySlots %5u ccid-driver: junk ccid-driver: this drivers requires that the reader supports T=1, TPDU or APDU level exchange and auto configuration - this is not available ccid-driver: enabling workaround for buggy SCM readers ccid-driver: bPowerSelect ......: 0x%02x (%s) ccid-driver: bBWI ..............: 0x%02x ccid-driver: wLevelParameter ...: 0x%04x%s ccid-driver: bProtocolNum ......: 0x%02x ccid-driver: bClockCommand .....: 0x%02x ccid-driver: bmChanges .........: 0x%02x ccid-driver: bClassGetResponse .: 0x%02x ccid-driver: bClassEnvelope ....: 0x%02x ccid-driver: bBMI ..............: 0x%02x ccid-driver: bFunction .........: 0x%02x ccid-driver: usb_bulk_write error: %s ccid-driver: usb_bulk_write failed: %d ccid-driver: writen to %d failed: %s ccid-driver: usb_intr_read error: %s ccid-driver: intr-in msg too short ccid-driver: notify slot change:ccid-driver: hardware error occured ccid-driver: unknown intr-in msg of type %02X An all inclusive hardware error occurredOverrun error while talking to the ICCParity error while talking to the ICCCCID timed out while talking to the ICCHost aborted the current activityccid-driver: CCID command failed: %s ccid-driver: sending abort sequence for seqno %d ccid-driver: usb_control_msg error: %s ccid-driver: usb_bulk_write error in abort_cmd: %s ccid-driver: usb_bulk_write failed in abort_cmd: %d ccid-driver: usb_bulk_read error in abort_cmd: %s ccid-driver: bulk-in msg in abort_cmd too short (%u) ccid-driver: unexpected bulk-in slot (%d) in abort_cmd ccid-driver: status: %02X error: %02X octet[9]: %02X ccid-driver: sending abort sequence succeeded ccid-driver: usb_bulk_read error: %s ccid-driver: read from %d failed: %s ccid-driver: bulk-in msg too short (%u) ccid-driver: unexpected bulk-in slot (%d) ccid-driver: bulk-in seqno does not match (%d/%d) ccid-driver: time extension requested (%02X,%02X) ccid-driver: unexpected bulk-in msg type (%02x) ccid-driver: bChainParameter ...: 0x%02x%s ccid-driver: bClockStatus ......: 0x%02x%s ccid-driver: protocol ..........: T=%d ccid-driver: bmFindexDindex ....: %02X ccid-driver: bmTCCKST1 .........: %02X ccid-driver: bGuardTimeT1 ......: %02X ccid-driver: bmWaitingIntegersT1: %02X ccid-driver: bClockStop ........: %02X ccid-driver: bIFSC .............: %d ccid-driver: bNadValue .........: %d ccid-driver: buffer[9] .........: %02X ccid-driver: dwClockFrequency ..: %u ccid-driver: dwDataRate ..... ..: %u ccid-driver: bMessageType ......: %02X ccid-driver: USB: CALLING USB_CLEAR_HALT ccid-driver: USB: RETRYING bulk_in AGAIN ccid-driver: sending escape sequence to switch to a case 1 APDU ccid-driver: provided buffer too short for received data (%u/%u) ccid-driver: T=1: got %c-block seq=%d err=%d%s ccid-driver: I-block with wrong seqno received ccid-driver: chaining requested but not supported for Secure operation ccid-driver: No retries supported for Secure operation ccid-driver: R-block with wrong seqno received on more bit ccid-driver: chaining not supported on Secure operation ccid-driver: T=1: S-block %s received cmd=%d for Secure operation ccid-driver: GetParameters failed ccid-driver: SetParameters failed (ignored) ccid-driver: T=1: put %c-block seq=%d%s ccid-driver: invalid response for S-block (Change-IFSD) ccid-driver: IFSD has been set to %d ccid-driver: T=1: requesting resync ccid-driver: T=1: 3 failed retries ccid-driver: unexpected ACK R-block received ccid-driver: T=1: S-block %s received cmd=%d ccid-driver: T=1: requesting an ifsc=%d ccid-driver: T=1: waittime extension of bwi=%d ccid-driver: T=1: resync ack from reader ccid-driver: usb_open failed: %s ccid-driver: found CCID reader %d (ID=%s) ccid-driver: failed to open `%s': %s ccid-driver: no CCID reader with ID %s ccid-driver: device not supported ccid-driver: usb_claim_interface failed: %d ccid-driver: no CCID readers found ccid-driver: no CCID reader with number %d ccid-driver: setting up transport for CardMan 4040 ccid-driver: using CCID reader %d (ID=%s) %h hhhjNhEaccid_transceiveccid_transceive_apdu_level scan_or_find_devicesccid_open_readerprepare_special_transport ../../g10/pkclist.cThis key belongs to us Use this key anyway? (y/N) untrusted_key.override--hidden-recipient%s: skipped: %s --hidden-encrypt-toCurrent recipients: %4u%c/%s %s "pklist.user_id.enterNo such user ID. Public key is disabled. no valid addressees iImMqQsSNo trust value assigned to: %4u%c/%s %s aka "%s" %d = I do NOT trust %d = I trust marginally %d = I trust fully %d = I trust ultimately m = back to the main menu s = skip this key q = quit Your decision? edit_ownertrust.valuefailed to get the keyblock Oops, PK not in keyblock No reason specifiedKey is supersededKey has been compromisedKey is no longer usedUser ID is no longer validreason for revocation: code=%02xrevocation comment: Note: This key has expired! No trust check due to `--trust-model always' option invalid trustlevel %u returned from validation layer %s: There is no assurance this key belongs to the named user %s: There is limited assurance this key belongs to the named user This key probably belongs to the named user It is NOT certain that the key belongs to the person named in the user ID. If you *really* know what you are doing, you may answer the next question with yes. you may not use %s while in %s mode %s: skipped: public key already present You did not specify a user ID. (you may use "-r") Enter the user ID. End with an empty line: skipped: public key already set as default recipient skipped: public key already set unknown default recipient "%s" %s: skipped: public key is disabled How much do you trust that this key actually belongs to the named user? Please decide how far you trust this user to correctly verify other users' keys (by looking at passports, checking fingerprints from different sources, etc.) %d = I don't know or won't say The minimum trust level for this key is: %s Do you really want to set this key to ultimate trust? (y/N) edit_ownertrust.set_ultimate.okayOoops; the key vanished - can't check the trust WARNING: Using untrusted key! WARNING: this key might be revoked (revocation key not present) WARNING: This key has been revoked by its designated revoker! WARNING: This key has been revoked by its owner! This could mean that the signature is forged. WARNING: This subkey has been revoked by its owner! Note: This key has been disabled. Note: Verified signer's address is `%s' Note: Signer's address `%s' does not match DNS entry trustlevel adjusted to FULL due to valid PKA info trustlevel adjusted to NEVER due to bad PKA info WARNING: This key is not certified with a trusted signature! There is no indication that the signature belongs to the owner. WARNING: We do NOT trust this key! The signature is probably a FORGERY. WARNING: This key is not certified with sufficiently trusted signatures! It is not certain that the signature belongs to the owner.        1 1 1 b1 1 7 9 7 9 8 8 8 do_we_trustdo_edit_ownertrust(insecure!)not securedo not use(INSECURE!)no default secret key: %s skipped "%s": duplicated skipped "%s": %s no valid signators key is not flagged as insecure - can't use it with the faked RNG! invalid default secret key: %s skipped: secret key already present this is a PGP generated Elgamal key which is not secure for signatures!../../g10/pubkey-enc.cDEK frame: (IDEA)DEK is:NOTE: key has been revokedold encoding of the DEK is not supported cipher algorithm %d%s is unknown or disabled oops: public key not found for preference check NOTE: secret key %s expired at %s WARNING: cipher algorithm %s not found in recipient preferences anonymous recipient; trying secret key %s ... okay, we are the anonymous recipient. get_itGPG_AGENT_INFOcan't connect to `%s': %s DISPLAYGPG_TTYTERM utf-8 (main key ID %s)Repeat passphrase Enter passphrase ../../g10/passphrase.cokay_cb_parm.pwcancelled by user %08lX%08lX %08lX%08lX %d 0Enter passphrase: passphrase.enterRepeat passphrase: passphrase.repeats2k->hash_algo %s %s. passphrase.askgpg-agent is not available in this session malformed GPG_AGENT_INFO environment variable gpg-agent protocol version %d is not supported problem with the agent - disabling agent use Reading passphrase from file descriptor %d ...You need a passphrase to unlock the secret key for user: "%.*s" %u-bit %s key, ID %s, created %s%s You need a passphrase to unlock the secret key for user: "%s" %u-bit %s key, ID %s, created %s (subkey on main key ID %s)can't query passphrase in batch mode agent_get_passphrasehash_passphrasehash_passphraseWARNING: Weak key detected - please change passphrase again. sk->protect.ivlen <= (sizeof(sk->protect.iv)/sizeof((sk->protect.iv)[0]))!((sk->skey[i]) && (mpi_get_flags (sk->skey[i])&4))generating the deprecated 16-bit checksum for secret key protection Invalid passphrase; please try againsecret key parts are not available protection algorithm %d%s is not supported protection digest %d is not supported not enough bytes for SHA-1 checksum not enough bytes for checksum ndata == ((p[0] << 8 | p[1]) + 7)/8 + 2../../g10/seckey-cert.cp == data+ndatanbytes == (nbits + 7)/8%s ... ndata >= 2protect_secret_keyprotect_secret_keydo_checkdo_check../../g10/encr-data.cdfx->refcountunsupported blocksize %u checkmdckey setup failed: %s dfx->cipher_hddfx->mdc_hashsize > 44dfx->eof_seenmdc_decode_filterWARNING: message was encrypted with a weak key in the symmetric cipher. problem handling encrypted packet decrypt_datadecrypt_datarelease_dfx_contextdecode_filtermdc_decode_filter../../g10/cipher.ccreatmdchashlen == 20writing MDC packet failed cipher_filterbuild_packet(ENCR_DATA) failed cipher_filterbuild_packet(pubkey_enc) failed: %s build symkey_enc packet failed: %s forcing symmetric cipher %s (%d) violates recipient preferences you can only encrypt to RSA keys of 2048 bits or less in --pgp2 mode unable to use the IDEA cipher for all of the keys you are encrypting to. WARNING: forcing symmetric cipher %s (%d) violates recipient preferences WARNING: `%s' is an empty file WARNING: forcing compression algorithm %s (%d) violates recipient preferences copying input to output failed: %s --output doesn't work for this command input line %u too long or missing LF encryption of `%s' failed: %s error creating passphrase: %s build symkey packet failed: %s --throw-keyidpubkey_encrypt failed: %s %s/%s encrypted for: "%s" ../../g10/encode.cdek->keylen <= 32DEK is: encrypt_filterreading from `%s' `%s' already compressed build_packet failed: %s using cipher %s encrypt_filterencode_seskeybuild onepass_sig packet failed: %s build_packet(PLAINTEXT) failed: %s key has been created %lu second in future (time warp or clock problem) key has been created %lu seconds in future (time warp or clock problem) checking created signature failed: %s WARNING: unable to %%-expand notation (too large). Using unexpanded. WARNING: unable to %%-expand policy URL (too large). Using unexpanded. WARNING: unable to %%-expand preferred keyserver URL (too large). Using unexpanded. build signature packet failed: %s (sigclass >= 0x10 && sigclass <= 0x13) || sigclass == 0x1F || sigclass == 0x20 || sigclass == 0x18 || sigclass == 0x19 || sigclass == 0x30 || sigclass == 0x28you can only clearsign with PGP 2.x style keys while in --pgp2 mode -----BEGIN PGP SIGNED MESSAGE----- NotDashEscaped: You need GnuPG to verify this message multiple files can only be detached signedyou can only detach-sign with PGP 2.x style keys while in --pgp2 mode WARNING: forcing digest algorithm %s (%d) violates recipient preferences %s/%s signature from: "%s" ../../g10/sign.csig->version>=4%c %d %d %02x %lu %s encryption will be used symc-signanysigning:make_keysig_packetmk_notation_policy_etcclearsign_file%d %sthe signature could not be verified. Please remember that the signature file (.sig or .asc) should be the first file given on the command line. 0 = %s 1 = %s 2 = %s 3 = %s 4 = %s Cancel Q = %s ask_revocation_reason.codeask_revocation_reason.textReason for revocation: %s (No description given) Is this okay? (y/N) ask_revocation_reason.okaykey incomplete key %s has no user IDs error reading keyblock: %s ../../g10/revoke.cgen_revoke.okayunknown protection algorithm ASCII armored output forced. key "%s" not found: %s To be revoked by: gen_desig_revoke.okayPlease select the reason for the revocation: (Probably you want to select %d here) Enter an optional description; end it with an empty line: secret key "%s" not found: %s no corresponding public key: %s public key does not match secret key! Create a revocation certificate for this key? (y/N) Secret parts of primary key are not available. NOTE: This key is not protected! Comment: A revocation certificate should follow make_keysig_packet failed: %s Revocation certificate created. Please move it to a medium which you can hide away; if Mallory gets access to this certificate he can use it to make your key unusable. It is smart to print this certificate and store it away, just in case your media become unreadable. But have some caution: The print system of your machine might store the data and make it available to others! (This is a sensitive revocation key) Create a designated revocation certificate for this key? (y/N) Comment: A designated revocation certificate should follow Revocation certificate created. no revocation keys found for "%s" gen_revokegen_desig_revoke%s: decryption failed: %s %s %4u%c/%s %s %4u%c/%s%s%c%c %c%c%c%c%c%c %s %s[revocation][self-signature]../../g10/keyedit.cmake_backsig failed: %s This key is not protected. Key is protected. Can't edit this key: %s change_passwd.empty.okay[%d] Digest: Features: Keyserver no-modifyNotations: %c%d [mdc] [no-ks-modify](%d)* (%d). (%d) keyedit.add_keyserverkeyedit.confirm_keyserverEnter the notation: keyedit.add_notationNo notations on user ID "%s" Skipping notation: %s=%s Removing notation: %s=%s Adding notation: %s=%s Removing all notations Proceed? (y/N) keyedit.confirm_notationUser ID "%s" compacted: %s User ID "%s": already clean :%u:%d:%08lX%08lX:%lu:%lu::uat:uid:r::::::::e::::::::%c::::::::,mdc,no-ks-modify%d,(sensitive)%s%c %4u%c/%s usage: %strust: %svalidity: %s*** This key has been disablederrUser ID "%s" is revoked.sign_uid.revoke_okay Unable to sign. User ID "%s" is expired.sign_uid.expire_okaysign_uid.nosig_okayUser ID "%s" is signable. Sign it? (y/N) sign_uid.sign_okaysign_uid.v4_promote_okaysign_uid.replace_expired_okaysign_uid.local_promote_okaysign_uid.dupe_okayNothing to sign with key %s This key has expired!sign_uid.expired_okaysign_uid.expiresign_uid.v4_on_v3_okay (0) I will not answer.%s sign_uid.classtrustsig_prompt.trust_valuetrustsig_prompt.trust_depthtrustsig_prompt.trust_regexpReally sign? (y/N) sign_uid.okayprimary_pk::%02x%c (non-revocable) (non-exportable)revoked by your key %s on %s uat:::::::::%u %luuid:::::::::user ID: "%s" ask_revoke_sig.expiredask_revoke_sig.oneask_revoke_sig.okayunodeno secret key Not signed by you. uid keyedit.delsig.validkeyedit.delsig.invalidkeyedit.delsig.unknownkeyedit.delsig.selfsigDeleted %d signature. Deleted %d signatures. Nothing deleted. Secret key is available. keyedit.prompt%-11s %s pub %4u%c/%s %s No user ID with index %d No subkey with index %d Key is revoked.keyedit.sign_revoked.okaykeyedit.sign_all.okaynrUnknown signature type `%s' pk && skkeyedit.v3_photo.okaykeyedit.remove.uid.okaykeyedit.keytocard.use_primaryCan't open `%s': %s keyedit.remove.subkey.okaysensitivekeyedit.v3_revoker.okaykeyedit.add_revokerkeyedit.add_revoker.okaykeyedit.revoke.uid.okaykeyedit.revoke.subkey.okayKey %s is already revoked. Set preference list to: keyedit.setpref.okaySave changes? (y/N) keyedit.save.okayQuit without saving? (y/N) keyedit.cancel.okayupdate failed: %s update secret failed: %s No user ID with hash %s save and quitshow key fingerprintlist key and user IDsselect user ID Nselect subkey Ncheck signaturescross-certifybacksigntsignnrsignadduidadd a user IDaddphotoadd a photo IDdeluiddelete selected user IDsdelphotoaddkeyadd a subkeyaddcardkeyadd a key to a smartcardkeytocardmove a key to a smartcardbkuptocarddelkeydelete selected subkeysaddrevokeradd a revocation keydelsigtogglelist preferences (expert)showpreflist preferences (verbose)setprefupdprefchange the passphrasepasswordchange the ownertrustrevsigrevuidrevoke selected user IDsrevphotorevkeyenableenable keydisabledisable keyshowphotoshow selected photo IDsminimizemoving a key signature to the correct place WARNING: no user ID has been marked as primary. This command may cause a different user ID to become the assumed primary. pub_keyblock->pkt->pkttype==PKT_PUBLIC_KEYsec_keyblock->pkt->pkttype==PKT_SECRET_KEYsigning subkey %s is already cross-certified subkey %s does not sign and so does not need to be cross-certified update_keysig_packet failed: %s Please select exactly one user ID. skipping v3 self-signature on user ID "%s" Oops; secret key not found anymore! Secret parts of primary key are stored on-card. Enter the new passphrase for this secret key. passphrase not correctly repeated; try againYou don't want a passphrase - this is probably a *bad* idea! Do you really want to do this? (y/N) protect_secret_key failed: %s Key has only stub or on-card key items - no passphrase to change. There are no preferences on a PGP 2.x-style user ID. Enter your preferred keyserver URL: Current preferred keyserver for user ID "%s": Are you sure you want to replace it? (y/N) Are you sure you want to delete it? (y/N) Current notations for user ID "%s": User ID "%s": %d signature removed User ID "%s": %d signatures removed User ID "%s": already minimized user ID "%s" is already revoked WARNING: a user ID signature is dated %d seconds in the future Subkey %s is already revoked. This key was revoked on %s by %s key %s This key may be revoked by %s key %sPlease note that the shown key validity is not necessarily correct unless you restart the program. Are you sure you still want to sign it? (y/N) User ID "%s" is not self-signed.The self-signature on "%s" is a PGP 2.x-style signature. Do you want to promote it to an OpenPGP self-signature? (y/N) Your current signature on "%s" has expired. Do you want to issue a new signature to replace the expired one? (y/N) Your current signature on "%s" is a local signature. Do you want to promote it to a full exportable signature? (y/N) "%s" was already locally signed by key %s "%s" was already signed by key %s Do you want to sign it again anyway? (y/N) This key is due to expire on %s. Do you want your signature to expire at the same time? (Y/n) You may not make an OpenPGP signature on a PGP 2.x key while in --pgp2 mode. This would make the key unusable in PGP 2.x. How carefully have you verified the key you are about to sign actually belongs to the person named above? If you don't know what to answer, enter "0". (1) I have not checked at all.%s (2) I have done casual checking.%s (3) I have done very careful checking.%s Your selection? (enter `?' for more information): Please enter the depth of this trust signature. A depth greater than 1 allows the key you are signing to make trust signatures on your behalf. Please enter a domain to restrict this signature, or enter for none. Are you sure that you want to sign this key with your key "%s" (%s) This will be a self-signature. WARNING: the signature will not be marked as non-exportable. WARNING: the signature will not be marked as non-revocable. The signature will be marked as non-exportable. The signature will be marked as non-revocable. I have not checked this key at all. I have checked this key casually. I have checked this key very carefully. sig:%c::%d:%08lX%08lX:%lu:%lu:You have signed these user IDs on key %s: signed by your key %s on %s%s%s Oops: no user ID for signature This signature expired on %s. Are you sure you still want to revoke it? (y/N) Create a revocation certificate for this signature? (y/N) You are about to revoke these signatures: Really create the revocation certificates? (y/N) Delete this good signature? (y/N/q)Delete this invalid signature? (y/N/q)Delete this unknown signature? (y/N/q)Really delete this self-signature? (y/N)error reading secret keyblock "%s": %s Need the secret key to do this. Please use the command "toggle" first. * The `sign' command may be prefixed with an `l' for local signatures (lsign), a `t' for trust signatures (tsign), an `nr' for non-revocable signatures (nrsign), or any combination thereof (ltsign, tnrsign, etc.). 1 user ID without valid self-signature detected %d user IDs without valid self-signatures detected Really sign all user IDs? (y/N) Hint: Select the user IDs to sign This command is not allowed while in %s mode. WARNING: This is a PGP2-style key. Adding a photo ID may cause some versions of PGP to reject this key. Are you sure you still want to add it? (y/N) You may not add a photo ID to a PGP2-style key. You must select at least one user ID. You can't delete the last user ID! Really remove all selected user IDs? (y/N) Really remove this user ID? (y/N) Really move the primary key? (y/N) You must select exactly one key. Command expects a filename argument Error reading backup key from `%s': %s You must select at least one key. Do you really want to delete the selected keys? (y/N) Do you really want to delete this key? (y/N) WARNING: This is a PGP 2.x-style key. Adding a designated revoker may cause some versions of PGP to reject this key. You may not add a designated revoker to a PGP 2.x-style key. Enter the user ID of the designated revoker: cannot appoint a PGP 2.x style key as a designated revoker you cannot appoint a key as its own designated revoker this key has already been designated as a revoker WARNING: appointing a key as a designated revoker cannot be undone! Are you sure you want to appoint this key as a designated revoker? (y/N) Really revoke all selected user IDs? (y/N) Really revoke this user ID? (y/N) Do you really want to revoke the entire key? (y/N) Do you really want to revoke the selected subkeys? (y/N) Do you really want to revoke this subkey? (y/N) Please remove selections from the secret keys. Please select at most one subkey. Changing expiration time for a subkey. Changing expiration time for the primary key. You can't change the expiration date of a v3 key Owner trust may not be set while using a user provided trust database Really update the preferences for the selected user IDs? (y/N) Really update the preferences? (y/N) Displaying %s photo ID of size %ld for key %s (uid %d) Key not changed so no update needed. No corresponding signature in secret ring sign selected user IDs [* see below for related commands]sign selected user IDs locallysign selected user IDs with a trust signaturesign selected user IDs with a non-revocable signaturemove a backup key to a smartcarddelete signatures from the selected user IDschange the expiration date for the key or selected subkeysflag the selected user ID as primarytoggle between the secret and public key listingsset preference list for the selected user IDsset the preferred keyserver URL for the selected user IDsset a notation for the selected user IDsrevoke signatures on the selected user IDsrevoke key or selected subkeyscompact unusable user IDs and remove unusable signatures from keycompact unusable user IDs and remove all signatures from keyv$Hs P} | {  q  z v _v w u au $u u t  Ȉ ˅  P c *  ƒ ; Ђ   k k  } z Nz Hs y Hs Hs Xy x bx Hx +x t w_1x __"U/REVf w $Xwr+`++ &)'3M(X_w  ,<k xaz !@ s(l/ 6O X _fqy#)*keyedit_menusign_uidsmenu_adduidmenu_addrevokermenu_addrevokermenu_backsignshow_key_with_all_namesmenu_revsigComment: Use "gpg --dearmor" for unpacking NOTE: a key's S/N does not match the card's one NOTE: primary key is online and stored on card NOTE: secondary key is online and stored on card error writing keyring `%s': %s no default secret keyring: %s WARNING: key %s contains preferences for unavailable algorithms on these user IDs: key %s: duplicated user ID detected - merged %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lunode->pkt->pkttype == PKT_PUBLIC_SUBKEY || node->pkt->pkttype == PKT_SECRET_SUBKEYWARNING: key %s may be revoked: fetching revocation key %s WARNING: key %s may be revoked: revocation key %s not present. "%s": preference for cipher algorithm %s "%s": preference for digest algorithm %s "%s": preference for compression algorithm %s it is strongly suggested that you update your preferences and re-distribute this key to avoid potential algorithm mismatch problems you can update your preferences with: gpg --edit-key %s updpref save Do you want to import this key? (y/N) key %s: PKS subkey corruption repaired key %s: no user ID for signature key %s: unsupported public key algorithm on user ID "%s" key %s: invalid self-signature on user ID "%s" key %s: no subkey for key binding key %s: unsupported public key algorithm key %s: invalid subkey binding key %s: removed multiple subkey binding key %s: no subkey for key revocation key %s: invalid subkey revocation key %s: removed multiple subkey revocation key %s: accepted non self-signed user ID "%s" key %s: non exportable signature (class 0x%02X) - skipped key %s: revocation certificate at wrong place - skipped key %s: invalid revocation certificate: %s - skipped key %s: subkey signature in wrong place - skipped key %s: unexpected signature class (0x%02X) - skipped this may be caused by a missing self-signature key %s: public key not found: %s no writable keyring found: %s key %s: public key "%s" imported key %s: doesn't match our copy key %s: can't locate original keyblock: %s key %s: can't read original keyblock: %s key %s: "%s" revocation certificate added key %s: direct key signature added dst->pkt->pkttype == PKT_USER_IDsrc->pkt->pkttype == PKT_USER_IDnode->pkt->pkttype == PKT_USER_IDdst->pkt->pkttype == PKT_PUBLIC_SUBKEY || dst->pkt->pkttype == PKT_SECRET_SUBKEYkey %s: "%s" %d new signatures key %s: "%s" %d signature cleaned key %s: "%s" %d signatures cleaned key %s: "%s" %d user ID cleaned key %s: "%s" %d user IDs cleaned key %s: secret key with invalid cipher %d - skipped key %s: already in secret keyring key %s: secret key not found: %s node->pkt->pkt.signature->sig_class == 0x20key %s: no public key - can't apply revocation certificate key %s: invalid revocation certificate: %s - rejected key %s: "%s" revocation certificate imported import signatures that are marked as local-onlyrepair damage from the pks keyserver during importdo not update the trustdb after importcreate a public key when importing a secret keyonly accept updates to existing keysremove unusable parts from key after importremove as much as possible from key after importTotal number processed: %lu skipped new keys: %lu w/o user IDs: %lu imported: %lu (RSA: %lu) unchanged: %lu new user IDs: %lu new subkeys: %lu new signatures: %lu new key revocations: %lu secret keys read: %lu secret keys imported: %lu secret keys unchanged: %lu not imported: %lu signatures cleaned: %lu user IDs cleaned: %lu ../../g10/import.cpub %4u%c/%s %s key %s: no user ID %08X%08X import.okaykey %s: skipped user ID "%s" key %s: skipped subkey key %s: no valid user IDs key %s: new key - skipped key %s: "%s" 1 new user ID key %s: "%s" %d new user IDs key %s: "%s" 1 new signature key %s: "%s" 1 new subkey key %s: "%s" %d new subkeys key %s: "%s" not changed sec %4u%c/%s %s key %s: secret key imported !node->nextskipping block of type %d %lu keys processed so far read_block: read error: %s [stream]import from `%s' failed: %s import-local-sigsrepair-pks-subkey-bugconvert-sk-to-pkimport-cleanimport-minimalallow-local-sigsrepair-hkp-subkey-bugimport-unusable-sigsimport-clean-sigsimport-clean-uidsimport_onemerge_sigsappend_uidappend_keymerge_keysigsimport_secret_oneimport_revoke_cert_Dqt.@(`T8 0 ` H H kT} 0@4FWARNING: nothing exported export-local-sigsexport-attributesexport-sensitive-revkeysexport-reset-subkey-passwdexport-cleanexport-minimalinclude-local-sigsinclude-attributesinclude-sensitive-revkeysexport-unusable-sigsexport-clean-sigsexport-clean-uidskey %s: not protected - skipped key %s: PGP 2.x style key - skipped key %s: key material on-card - skipped about to export an unprotected subkey failed to unprotect the subkey: %s WARNING: secret key %s does not have a simple SK checksum export signatures that are marked as local-onlyexport attribute user IDs (generally photo IDs)export revocation keys marked as "sensitive"remove the passphrase from exported subkeysremove unusable parts from key during exportremove as much as possible from key during exportundefinedmarginalfullultimate../../g10/trustdb.ckey unavailableinvalid signaturesignature supercededtrustdb: sync failed: %s trustdb.gpg cd %s rm %s insert ownertrust %u can't init trustdb: %s using %s trust model public key %s not found: %s force trust for key %s to %s insert min_ownertrust %u <[^>]+[@.]>$YESvalidate_key_list failed %d:%08lX%08lX:K::%c:::: %d:%08lX%08lX:U:::%c:::next trustdb check due at %s please do a --check-trustdb checking the trustdb [ revoked][ expired][ unknown][ undef ][marginal][ full ][ultimate]no need for a trustdb check external p    0 P < < < ; < < `< clean_one_uidclean_sigs_from_uidinit_trustdb#-eqnmfuuidnode->pkt->pkttype==PKT_USER_IDcompacting user ID "%s" on key %s: %s removing signature from key %s on user ID "%s": %s key %s: accepted as trusted key trust record %lu, req type %d: read failed: %s trust record %lu is not of requested type %d trust record %lu, type %d: write failed: %s You may try to re-create the trustdb using the commands: gpg2 --export-ownertrust > otrust.tmp gpg2 --import-ownertrust < otrust.tmp If that does not work, please consult the manual `%s' is not a valid long keyID update ownertrust from %u to %u unable to use unknown trust model (%d) - assuming %s trust model key %s occurs more than once in the trustdb key %s: no public key for trusted key - skipped key %s marked as ultimately trusted trustdb: searching trust record failed: %s trustdb: record %lu is not a trust record clearing ownertrust (old value %u) clearing min_ownertrust (old value %u) %d keys processed (%d validity counts cleared) no ultimately trusted keys found public key of ultimately trusted key %s not found %d marginal(s) needed, %d complete(s) needed, %s trust model key %08lX%08lX: update min_ownertrust from %u to %u key %08lX%08lX: overriding ownertrust `%s' with `%s' keydb_search_reset failed: %s ooops: invalid pkttype %d encountered regexp `%s' (`%s') on `%s': %s trust sig on %s, sig depth is %d, kr depth is %d replacing trust value %d with %d and depth %d with %d depth: %d valid: %3d signed: %3d trust: %d-, %dq, %dn, %dm, %df, %du unable to update trustdb version record: write failed: %s error getting main key %s of subkey %s: %s 10 translator see trustdb.c:uid_trust_string_fixedno need for a trustdb update with `%s' trust model no need for a trustdb check with `%s' trust model # List of assigned trustvalues, created %s # (Use "gpg --import-ownertrust" to restore them) changing ownertrust from %u to %u error finding trust record in `%s': %s TrustDB: %s line too longcolon missinginvalid fingerprintownertrust value missingsetting ownertrust to %u inserting ownertrust of %u read error in `%s': %s Error: The trustdb is corrupted. trustdb rec %lu: lseek failed: %s trustdb rec %lu: write failed (n=%d): %s version, td=%lu, f=%lu, m/c/d=%d/%d/%d tm=%d nc=%lu (%s) can't acquire lock - giving up upd_hashtable: read failed: %s upd_hashtable: write htbl failed: %s upd_hashtable: read item failed: %s hashtable has invalid indirections. upd_hashtable: read hlst failed: %s upd_hashtable: write hlst failed: %s upd_hashtable: write ext hlst failed: %s upd_hashtable: write new hlst failed: %s upd_hashtable: update htbl failed: %s hashtbl %lu: %lu/%d points to an invalid record %lu %s: error reading version record: %s trustdb: lseek to end failed: %s %s: failed to create hashtable: %s %s: error updating version record: %s migrate_from_v2: lseek failed: %s migrate_vfrom_v2: read error or short read migrate_from_v2: read error or short read failed to recreate version record of `%s' failed to write trust record of `%s' migrated %d version 2 ownertrusts trustdb: read failed (n=%d): %s %lu: read expected rec type %d, got %d %s: version record with recnum %lu %s: invalid record type %d at recnum %lu %s: error reading free record: %s %s: error writing dir record: %s %s: failed to zero a record: %s %s: failed to append a record: %s %s: error writing version record: %s %s: directory does not exist! %s: failed to create version record: %shashtable has invalid indirections lookup_hashtable: read item failed: %s lookup_hashtable: read hlst failed: %s drop_from_hashtable: read failed: %s drop_from_hashtable: write htbl failed: %s drop_from_hashtable: read item failed: %s drop_from_hashtable: read hlst failed: %s hashtbl %lu: %lu/%d points to wrong record %lu rec %5lu, blank free, next=%lu htbl,hlst, next=%lu,trust , ot=%d, d=%d, vl=%lu valid , v=%d, next=%lu unknown type %d ../../g10/tdbio.cunusedrecnumdb_fd == -1can't create lock for `%s' NOTE: trustdb not writable gpgfound %d ownertrust records can't truncate `%s': %s failed to sync `%s' %s: invalid trustdb trustdb: lseek failed: %s %s: not a trustdb file %s: invalid file version %d can't access `%s': %s %s: invalid trustdb created %s: trustdb created lookup_hashtable failed: %s hashtable read failed: %s create_hashtabletdbio_new_recnumtdbio_write_recordopen_dbtdbio_set_dbnameput_record_into_cacheput_record_into_cacheOops; key not found anymore! %s: get secret key: %s delete_key.secret.okaydelete_key.okaydeleting keyblock failed: %s %s: delete key failed: %s (unless you specify the key by fingerprint) can't do this in batch mode without "--yes" Delete this key from the keyring? (y/N) This is a secret key! - really delete? (y/N) ownertrust information cleared there is a secret key for public key "%s"! use option "--delete-secret-keys" to delete it first. ../../g10/keygen.c!sk->is_protected)(1:e%u:)(1:p%u:)(1:q%u:%lu:SignCertifyEncryptAuthenticatepreference `%s' duplicated too many cipher preferences too many digest preferences writing direct signature SsEeAaQq11223300Current allowed actions: (%c) Finished keygen.flags (%d) DSA and Elgamal (%d) DSA (sign only) (%d) RSA (sign only) (%d) RSA (encrypt only) keygen.algokeygen.sizeRequested keysize is %u bits pubkey_generate failed: %s dsa2_generate failed: %s auth%s:%d: invalid usage list seconds=Real name: keygen.nameInvalid character in name Email address: keygen.emailNot a valid email address keygen.commentInvalid character in comment NnCcEeOoQqkeygen.userid.cmdKey is valid for? (0) keygen.validSignature is valid for? (%s) siggen.validinvalid value Key does not expire at all Key expires at %s Signature expires at %s Is this correct? (y/N) keygen.valid.okayReally create? (y/N) keygen.sub.okayKey generation failed: %s S9 S8 S7 S3 S2 S1 H8 H2 H9 H10 H11 Z2 Z3 Z1no-mdckey generation failed: %s communication error with SCD keygen.cardsub.okayoutctrl->pub.streamoutctrl->sec.streamwriting public key to `%s' writing secret key to `%s' pri_skwriting self signature nskey <= 6 && npkey < nskeysk_%08lX%08lX.gpgbuild packet failed: %s can't write public key: %s can't write secret key: %s %s: no Key-Type specified %s:%d: invalid algorithm %s:%d: invalid keyserver url dek%s:%d: invalid creation date %s:%d: invalid expire date %s: no User-ID specified %echo%dry-run%commit%pubring%secringskipping control `%s' (%s) missing colonmissing argumentunknown keywordduplicate keyword%s:%d: %s %s:%d: read error encrypt sign Key generation canceled. [internal]Key-TypeKey-LengthKey-UsageSubkey-TypeSubkey-LengthSubkey-UsageName-RealName-EmailName-CommentExpire-DateCreation-DatePassphrasePreferencesRevokerHandleKeyserver((sk->pubkey_algo)==1 || (sk->pubkey_algo)==2 || (sk->pubkey_algo)==3 )too many compression preferences You need a Passphrase to protect your secret key. You don't want a passphrase - this is probably a *bad* idea! I will do it anyway. You can change your passphrase at any time, using this program with the option "--edit-key". NOTE: Bad translation at %s:%d. Please report. Possible actions for a %s key: (%c) Toggle the sign capability (%c) Toggle the encrypt capability (%c) Toggle the authenticate capability Please select what kind of key you want: (%d) RSA and RSA (default) (%d) Elgamal (encrypt only) (%d) DSA (set your own capabilities) (%d) RSA (set your own capabilities) %s keys may be between %u and %u bits long. What keysize do you want for the subkey? (%u) What keysize do you want? (%u) We need to generate a lot of random bytes. It is a good idea to perform some other action (type on the keyboard, move the mouse, utilize the disks) during the prime generation; this gives the random number generator a better chance to gain enough entropy. keysize invalid; using %u bits keysize rounded up to %u bits WARNING: some OpenPGP programs can't handle a DSA key with this digest size invalid creation date in line %d You need a user ID to identify your key; the software constructs the user ID from the Real Name, Comment and Email Address in this form: "Heinrich Heine (Der Dichter) " Name may not start with a digit Name must be at least 5 characters long You are using the `%s' character set. You selected this USER-ID: "%s" Please don't put the email address into the real name or the comment Change (N)ame, (C)omment, (E)mail or (Q)uit? Change (N)ame, (C)omment, (E)mail or (O)kay/(Q)uit? Please correct the error first Please specify how long the key should be valid. 0 = key does not expire = key expires in n days w = key expires in n weeks m = key expires in n months y = key expires in n years Please specify how long the signature should be valid. 0 = signature does not expire = signature expires in n days w = signature expires in n weeks m = signature expires in n months y = signature expires in n years Signature does not expire at all Your system can't display dates beyond 2038. However, it will be correctly handled up to 2106. make_keysig_packet failed for backsig: %s build_packet failed for backsig: %s writing key binding signature NOTE: creating subkeys for v3 keys is not OpenPGP compliant invalid item `%s' in preference string Note that the key does not use the suggested creation date dry-run mode - key generation skipped writing secret key stub to `%s' storing key onto card failed: %s can't create backup file `%s': %s NOTE: backup of card key saved to `%s' no writable public keyring found: %s no writable secret keyring found: %s error writing public keyring `%s': %s error writing secret keyring `%s': %s public and secret key created and signed. Note that this key cannot be used for encryption. You may want to use the command "--edit-key" to generate a subkey for this purpose. %s:%d: specified Key-Usage not allowed for algo %d %s:%d: specified Subkey-Usage not allowed for algo %d %s:%d: invalid revocation key %s:%d: only one ring name is set parameter block does not start with "Key-Type"save_unprotected_key_to_cardgenerate_card_subkeypairwrite_keybindinggenerate_subkeypairdo_create 88!8+878E8R8\8g8 t88 88 8 88get_parameter_u32ask_user_idproc_parameter_filedo_generate_keypairwrite_direct_sigwrite_selfsigsgen_card_key_with_backupgenerate_raw_keyask_expire_intervalmake_backsigset_one_pref../../g10/pipemode.cnested begin of stream invalid state for @> invalid state for @t invalid state for @. pipemode_filterEOF encountered at wrong state @@ not allowed in current state invalid state for operation code invalid operation for this state invalid escape sequence 0x%02x in stream                                                                       @ pipemode_filtermake_controlNo help availableNo help available for `%s'keygen.algo.rsa_seEnter the size of the keykeygen.size.huge.okayAnswer "yes" or "no"keygen.size.large.okaykeyedit.updpref.okayIt's up to you to assign a value here; this value will never be exported to any 3rd party. We need it to implement the web-of-trust; it has nothing to do with the (implicitly created) web-of-certificates.To build the Web-of-Trust, GnuPG needs to know which keys are ultimately trusted - those are usually the keys for which you have access to the secret key. Answer "yes" to set this key to ultimately trusted If you want to use this untrusted key anyway, answer "yes".Enter the user ID of the addressee to whom you want to send the message.Select the algorithm to use. DSA (aka DSS) is the Digital Signature Algorithm and can only be used for signatures. Elgamal is an encrypt-only algorithm. RSA may be used for signatures or encryption. The first (primary) key must always be a key which is capable of signing.In general it is not a good idea to use the same key for signing and encryption. This algorithm should only be used in certain domains. Please consult your security expert first.Enter the required value as shown in the prompt. It is possible to enter a ISO date (YYYY-MM-DD) but you won't get a good error response - instead the system tries to interpret the given value as an interval.Enter the name of the key holderplease enter an optional but highly suggested email addressPlease enter an optional commentN to change the name. C to change the comment. E to change the email address. O to continue with key generation. Q to to quit the key generation.Answer "yes" (or just "y") if it is okay to generate the sub key.When you sign a user ID on a key, you should first verify that the key belongs to the person named in the user ID. It is useful for others to know how carefully you verified this. "0" means you make no particular claim as to how carefully you verified the key. "1" means you believe the key is owned by the person who claims to own it but you could not, or did not verify the key at all. This is useful for a "persona" verification, where you sign the key of a pseudonymous user. "2" means you did casual verification of the key. For example, this could mean that you verified the key fingerprint and checked the user ID on the key against a photo ID. "3" means you did extensive verification of the key. For example, this could mean that you verified the key fingerprint with the owner of the key in person, and that you checked, by means of a hard to forge document with a photo ID (such as a passport) that the name of the key owner matches the name in the user ID on the key, and finally that you verified (by exchange of email) that the email address on the key belongs to the key owner. Note that the examples given above for levels 2 and 3 are *only* examples. In the end, it is up to you to decide just what "casual" and "extensive" mean to you when you sign other keys. If you don't know what the right answer is, answer "0".Answer "yes" if you want to sign ALL the user IDsAnswer "yes" if you really want to delete this user ID. All certificates are then also lost!Answer "yes" if it is okay to delete the subkeyThis is a valid signature on the key; you normally don't want to delete this signature because it may be important to establish a trust connection to the key or another key certified by this key.This signature can't be checked because you don't have the corresponding key. You should postpone its deletion until you know which key was used because this signing key might establish a trust connection through another already certified key.The signature is not valid. It does make sense to remove it from your keyring.This is a signature which binds the user ID to the key. It is usually not a good idea to remove such a signature. Actually GnuPG might not be able to use this key anymore. So do this only if this self-signature is for some reason not valid and a second one is available.Change the preferences of all user IDs (or just of the selected ones) to the current list of preferences. The timestamp of all affected self-signatures will be advanced by one second. Please enter the passhrase; this is a secret sentence Please repeat the last passphrase, so you are sure what you typed in.Give the name of the file to which the signature appliesAnswer "yes" if it is okay to overwrite the filePlease enter a new filename. If you just hit RETURN the default file (which is shown in brackets) will be used.You should specify a reason for the certification. Depending on the context you have the ability to choose from this list: "Key has been compromised" Use this if you have a reason to believe that unauthorized persons got access to your secret key. "Key is superseded" Use this if you have replaced this key with a newer one. "Key is no longer used" Use this if you have retired this key. "User ID is no longer valid" Use this to state that the user ID should not longer be used; this is normally used to mark an email address invalid. If you like, you can enter a text describing why you issue this revocation certificate. Please keep this text concise. An empty line ends the text. KH\Lܯ,MNhM2MKN2K3KIK^KIK4O4IKE3TP|3xP3P3P4pQIK2QIKIKIK W=TWWWXYYuK[[ۿ[D@\'|\'\, ]Gh_ldapshkps VERSION %d PROGRAM %s SCHEME %s OPAQUE %s AUTH %s HOST %s PORT %s PATH %s OPTION %s COMMAND GET 0x0x%08lX%08lX 0x%08lX 0x0000000000000000 ../../g10/keyserver.crequesting key %s from %s COMMAND GETNAME searching for names from %s COMMAND SEND INFO %08lX%08lX BEGIN supu%sb:%08lX%08lX:%u:%u:%u:%u:sig:%08lX%08lX:%X:%u:%u INFO %08lX%08lX END KEY %08lX%08lX BEGIN KEY %08lX%08lX END sending key %s to %s COMMAND SEARCH searching for "%s" from %s no keyserver action! VERSION PROGRAM OPTION OUTOFBANDSEARCH BEGIN ENDinfo:(%d) %s %d bit unknown key %s%08lXkey %skey key not found on keyserver sendkeyserver timed out keyserver internal error _pgpkey-ldap._tcp.%s:%uKeys %d-%d of %d for "%s". keysearch.promptQ "%s" not a key ID: skipping string!=((void *)0)x-broken-hkpbroken-http-proxyx-hkp/mailtorefreshing 1 key from %s refreshing %d keys from %s no-honor-http-proxyno-http-proxyno-use-temp-filesmax-cert-sizeinclude-revokedinclude-subkeyskeep-temp-filesrefresh-add-fake-v3-keyidshonor-keyserver-urlhonor-pka-record                                               keyserver_spawnprint_keyrecparse_keyserver_urino keyserver known (use option --keyserver) # This is a GnuPG %s keyserver communications file requesting key %s from %s server %s searching for names from %s server %s sending key %s to %s server %s searching for "%s" from %s server %s invalid keyserver protocol (us %d!=handler %d) WARNING: keyserver handler from a different version of GnuPG (%s) keyserver did not send VERSION key "%s" not found on keyserver no handler for keyserver scheme `%s' action `%s' not supported with keyserver scheme `%s' gpgkeys_%s does not support handler version %d keyserver communications error: %s Enter number(s), N)ext, or Q)uit > WARNING: unable to refresh key %s via %s: %s WARNING: unable to fetch URI %s: %s WARNING: unable to parse URI %s include revoked keys in search resultsinclude subkeys when searching by key IDuse temporary files to pass data to keyserver helpersdo not delete temporary files after using themautomatically retrieve keys when verifying signatureshonor the preferred keyserver URL set on the keyhonor the PKA record set on a key when retrieving keysjpgimage/jpegimage/x-unknownxloadimageeogeog %ino photo viewer set %08lX%08lX.%sunable to display photo ID! photoid.jpeg.addphotoid.jpeg.size`%s' is not a JPEG file photoid.jpeg.okayxloadimage -fork -quiet -title 'KeyID 0x%k' stdindisplay -title 'KeyID 0x%k' %i Pick an image to use for your photo ID. The image must be a JPEG file. Remember that the image is stored within your public key. If you use a very large picture, your key will become very large as well! Keeping the image close to 240x288 is a good size to use. Enter JPEG filename for photo ID: unable to open JPEG file `%s': %s This JPEG is really large (%d bytes) ! Are you sure you want to use it? (y/N) Is this photo correct (y/N/q)? unnatural exit of external program WARNING: unable to remove tempfile (%s) `%s': %s WARNING: unable to remove temp directory `%s': %s system error while calling external program: %s unable to execute external program unable to read external program response: %s external program calls are disabled due to unsafe options file permissions args expanded to "%s", use %u, keep %u unable to execute program `%s': %s unable to execute shell `%s': %s system() command is %s tempin.bintempout.bintempin.txttempout.txtTMPDIRTMP/tmp%s/gpg-XXXXXX%s/%s../../g10/exec.cexpanding string "%s" %SHELL/bin/shexeclp: %s execlp: %s -c %s -cusing temp file `%s' set_exec_path: %s exec_writecan't disable cipher algo %d: table full cipher_decrypt: invalid mode %d cipher_encrypt: invalid mode %d WARNING: cipher_setiv: ivlen=%u blklen=%u cipher_open: algorithm %d not available ../../cipher/cipher.c!(nbytes%c->blocksize)cipher %d w/o blocksize cipher %d not found cipher %d w/o key length RIJNDAELAESRIJNDAEL192AES192RIJNDAEL256AES256cipher_decryptcipher_encryptsetup_cipher_table../../cipher/pubkey.cELGno decrypt() for %d no encrypt() for %d no verify() for %d no sign() for %d pubkey_sign: algo=%d skey: data: sig:pubkey_decrypt: algo=%d plain:pubkey_encrypt: algo=%d pkey: encr:can't disable pubkey algo %d: table full setup_pubkey_tableOops: md debug already started more than algorithm in md_read(0) WARNING: no length for md algo %d WARNING: more than algorithm in md_get_algo() md_enable: algorithm %d not available more than algorithm in md_digest(0) dbgmd-%05d.%.10smd debug: can't open %s ../../cipher/md.cno asn for md algo %d load_digest_modulemd_digestmd_readmd_writeextension `%s' already registered DES maintenance test failed.Triple-DES test failed.DES weak key detection failedTriple-DES SSLeay test pattern no. %d failend on encryption.Triple-DES SSLeay test pattern no. %d failend on decryption.1dUZR8IgL&18IgL&18IgL&1QEKX-D qxn*CCCBD0YW7B@#Eg#Eg#Egsomedata=O#EgUUUUUUUU#Egsomedata#EgUUUUUUUUܺvT2somedataHcbrRg fY!dj4Wsquiggle}*f0[~r)tF4 b2[@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @ @@@ @ @@ @@ @@@ @@ @@@ @@@@ @ @ @@@@ @@@@@ @ @ @@@@ @@ @@ @ @@ @@@ @@@@ @ @@ @@@@@ @@ @@                                                             B@@@BB@@@@BBB@BBB@B@@B@BBBB@B@@@TWOFISHTWOFISH128Twofish-128 test encryption failed.Twofish-128 test decryption failed.Twofish-256 test encryption failed.Twofish-256 test decryption failed..Sj/4TE\k0K5UF $]l1+Ls6͂VbGO%^'fm֜y2h,Z)"M`{;t7oWcܬH PBx&e_(!Ygnz: Aî3Di-R J[*#Nar=|<}u>8?vp~X dw@9I QCqȡ @My>|7n 0`[!BEY)R (P 4hc{|7n 0`[!BEY)R (P 4hc{ 3`&_\v*IR!_ē ّŅ9I-O1;G#mFN>-idH*Oe/x\Xz՘WKgZd(c?)3&_v*I!9ͭ1#N-HOex\XWgdcid*/zKZ(?)B3||&_==סv*Ia!s?ٵmmŮxx9mřͤvv>>1gˋG[#``ݰjjMMN-|UUHZ~~O!!ze&^^xfZZ\KeeXNbbE@@W33g^d}OOjc/ttu \\t<3--00I..IIhrFFDUwwبMC((i))y.JY BBnG//49##5bj녅"ɡqq𐐛SዋNNo>oo TRۻ{/ii99 a#PDllF''%vІPPVU Q%zz99٩gqRRevEEKKࠀZZfxjjcc**68T Cb5$AAwl((C2u{{7& pDD~~ZHzжG$$<0祄kkAT``#E::[h=Y!ff1oo>WWc[M.mmكQS]]c|hh;?00֥zz%  5㧧#a鯌:\\ s11',v%VV {Nk44SjÙ[[GGk""ȽEnⳳtt/fXXV +^^,,µIIϕ~}} d wm9j||3qqb7q=yQ >>ܭ??-$vvUU@@xx%%͹MwwUD PP077ӡ@aa4NNTTlpss*;;Rҟ A{؈Og1''Fgg'88( HHx`.LLeeK\++DZoBB RJJ==_Y :Ia|-!!OBrr;//GH,mF<)iOO}d*..Iii/\^zчddե&&K`Z66"(uu?y)--3B|3|&=_=סv䔁*Ias!ė?mmxxm9vv>>g1G[`#`jjMMN|-ޝUUZ~H~!O!z&e^^fZxZKe\eNbXbE@@3W3g^}OdOjc/ttu \\t3-<-00I..IIrFhFUwDwبM(C()iy)ّ.ѬJYּ֨ BBn/G/9#4#b5j܅"qqSԋNNo>ooT R{i/i99 #aôDlPlF''v%PPVUQ %zz٩9ِgqqReevEKfxZfݰjc68*6T TC Cb5b$$wlAwC(2u27{ԛ&p pDZH~ZzzЌGG<0$o>Wc[[MM.mQSSc|]c;h;??֥0%z% 55#a#鯀:\s ',1'v%v V{{NkS4jęÙ[GkkȽ"Enn/t/f̙XVԋ ++^µ,‰I~~ } ddw m9mjj3|ѡqb7q7=y=Q Qܭ>-$?-vU؂@x͹%MUDwU  P00ӡ7@@4a4NlpTl*s*R;R A {؈OOg1gF'F'g( 8(x`Hx..LK\eKDZ+oo B RJ_=YY ::Iaa|-|O!BB;r۸G/HH,m,FW)i)}dO}*I.I/i\\^^zЇчdK&``Z"(6"?uy)y3<-3_Ly_ʖX5XĜCUMY8}8W3itSittėVVr~JJ"NXbN_94#9nDPlD]2]rhFr&e&͓Ȟւ+nP@pP܅u u2ߍL)Ls!s ]Qo6BJ^lV@ ;Un.F򢂷[N WsM,p !oTO,2#&5 ã ßX\,2/*ZԑÞkxTBLOWFISHabcdefghijklmnopqrstuvwxyz2NBlowfish selftest failed (1).Blowfish selftest failed (2).Blowfish selftest failed (3).Blowfish selftest failed (4).j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:CAST5CAST5 selftest failed (%s). @0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #PhꃢRijndael-128 test encryption failed.Rijndael-128 test decryption failed.Rijndael-192 test encryption failed.Rijndael-192 test decryption failed.Rijndael-256 test encryption failed.Rijndael-256 test decryption failed.QP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% Ky xZݨ31Y'_`QJ -zɜ;M*W^EL;k5f'q)|_ REHKEWYs7}:o-a vm`dwmzRYڛ[Tщ@ĊIN>7,%1<+&MFCMQP_[u‰j{˄aiГ|gٞw=3!/2 9$/vM֍xDۆj_̛dVNi@`R{\r >!0("3,:= 6+ 2?(% necntsyxޱZIиWB£@_̪MTAO]Sywek1?-# | GuLnQgZX>kQ3`J$}C)v4b=o&x /uV3[8L% A.al{vUXOB һ=ܲ0Ω'*zGhW^EL;k5f'q)|_ REHKEWYs7}:o-a vm`dwmzڕRYћ[T̉@CLJIN>7,%1<+&FMMCPQ[_ju‰a{˄|iГwgٞ=3!/29 $/vMֆxDۛj_̐dVNi@`R{\r >!0("3,:=6 + 2?( %enncstxyIޱZBиW_£@T̪MAO]Sywek1?-# G| LuQnZgkX>`Q3}J$vC)4b=o &x/u3V8[%L. Aal{vUXOB һ=ܲ0Ω'*hW^ELk;f5q'|)_R EHKEWY7s:}-o amv`wdzmYڕRTћ[C̉@NLJI>7,%1<+&FMMCPQ[_ju„a{˓|iОwg=3!/29 $/֍vMۆxD̛j_dVNi@`R{\r >!0("3,:= 6+ 2?(% necntsyxZIޱWBи@_£MT̪AO]SywekӲ1?-#  G|LuQnZg>kX3`Q$}J)vCb4o=x &u/V3[8L%A. al{vUXOB =һ0ܲ'Ω*W^ELk;f5q'|)_R EHKEWY7s:}-o avm`dwmzRYڕ[Tћ@C̉INLJ>7,%1<+&FMMCPQ[_‰ju˄a{Г|iٞwg=3!/29 $/M֍vDۆx_̛jVdiN`@{Rr\ !>(03":,= 6+ 2?(% necntsyxZI޸WBУ@_ªMTAO]Sywek1?-# | GuLnQgZX>kQ3`J$}C)v4b=o&x /uV3[8L% A.al{vUXOB =Ҳ0ܩ'Π*G^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,c|w{ko0g+׫vʂ}YGԢr&6?4q1#'u ,nZR;ֳ)/S [j˾9JLXCM3EPfHa5WiَU(ߌ BhA-T @6lM/^c5j}wqr  !"#$&'()+,-.jEߕ!] ּG  vwtuwpqrgCQ͚x K"x3Q6CCAMELLIA128CAMELLIA192CAMELLIA256CAMELLIA128 test encryption failed.CAMELLIA128 test decryption failed.CAMELLIA192 test encryption failed.CAMELLIA192 test decryption failed.CAMELLIA256 test encryption failed.CAMELLIA256 test decryption failed.ELG-E../../cipher/elgamal.celg p= elg g= elg y= elg x= choosing a random k of %u bitschoosing a random x of size %uElgamal operation: encrypt, decrypt failed gen_kw    (19@HOgenerateRSA-ERSA-Sphi= f= n= e= d= u= RSA operation: public, secret failed RSA operation: secret, public failed ../../cipher/primegen.coverflow in prime generation prime : factor q: factor q0: factor pi: bit sizes: prime=%u, q=%u, q0=%u, p%d=%uchecking g: mpi_cmp( x, nminus1 ) < 0 && mpi_cmp_ui( x, 1 ) > 0can't generate a prime with less than %d bits can't gen prime with pbits=%u qbits=%u gen prime: pbits=%u qbits=%u fbits=%u/%u n=%d generate_elg_primem_out_of_nis_prime../../cipher/random.ccan't lock `%s': %s waiting for lock on `%s'... can't write `%s': %s can't close `%s': %s can't stat `%s': %s can't read `%s': %s No way to gather entropy for the RNG WARNING: using insecure random number generator!! The random number generator is only a kludge to let it run - it is in no way a strong RNG! DON'T USE ANY DATA GENERATED BY THIS PROGRAM!! random usage: poolsize=%d mixed=%lu polls=%lu/%lu added=%lu/%lu outmix=%lu getlvl1=%lu/%lu getlvl2=%lu/%lu note: random_seed file not updated `%s' is not a regular file - ignored note: random_seed file is empty WARNING: invalid size of random_seed file - not used fast_random_pollset_random_seed_fileread_poolC0DSAchoosing a random k ../../cipher/dsa.cnbits >= 512qbits >= 160qbits %8 == 0choosing a random x dsa p= dsa q= dsa g= dsa y= dsa x= DSA:: sign, verify failed generategenerate/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqcan't open %s: %s stat() off %s failed: %s /dev/random/dev/urandomselect() error: %s Not enough random bytes available. Please do some other work to give the OS a chance to collect more entropy! (Need %d more bytes) bogus read from random device (n=%d) read error on random device: %s "(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDltrying to load an extension while still setuid _idea_get_infoinvalid module `%s': %s ppp,,,'''WWW555 AAA###kkkEEE!!!OOONNNeee|||>>>000___^^^ 999GGG]]]===ZZZQQQVVVlllMMM fff---ttt+++ LLL444~~~vvvmmm111XXX:::aaa222SSS"""DDDzzz$$$```iiiPPP}}}bbbTTT[[[dddHHHuuu ???\\\JJJ333sssgggRRR&&&777;;;oooKKKccc...yyynnn)))///YYYxxxjjjFFFqqq%%%BBBrrrUUU 666III***hhh<<<888@@@((({{{CCCwwwXXXgggNNN jjj]]]FFF'''222KKKBBB:::%%%{{{ qqq___>>>|||```444MMMrrrzzz555aaaZZZ$$$VVV@@@ccc 333hhh oooSSSbbb...(((ttt666"""888ddd999,,,000DDDeeekkk###HHHQQQUUUAAACCC///<<<+++ GGG~~~)))!!!fff;;;777LLLnnnvvv---&&&}}}\\\OOO???yyyRRRmmm^^^iii111 uuuJJJWWWEEEsssYYYlllTTTxxxpppIIIPPPwww***[[[===888AAAvvvٓ```rrr«uuuWWWɢҐ'''IIICCC\\\>>>gggnnn///ⅅ SSSeee꣣쀀---kkk+++666ņMMM333fffXXX::: xxxBBB&&&aaa???;;;Ԙ苋 ,,,oooNNN yyy"""YYY===tttTTT000~~~(((UUUhhhPPP111***ppp222iiibbb$$$EEEsssmmmJJJ...%%%HHH{{{οqqq)))llldddcccKKK___FFF777^^^GGG[[[ZZZ<<>>^^^ 999]]]ZZZQQQlllttt+++444vvvmmm:::222SSSzzz$$$```iiibbbTTTddduuu ݇͐sssRRRƁoooccc)))///xxxqqqԫrrr666***<<<@@@ӻCCCwww'''555 AAA!!!NNNeee000___GGG===VVVMMM fff--- LLL~~~111XXXaaa"""DDDPPP}}}[[[HHH???\\\JJJ333ggg&&&777;;;KKK...yyynnnYYYjjjFFF%%%BBBUUU IIIhhh888((({{{Ǟ../../mpi/mpi-pow.c!bp_marker!mp_markermpi_powm../../mpi/mpi-mpow.ci==kk < 10idx >= 0 && idx < (1<Copyright (C) 2008 Free Software Foundation, Inc.This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. This is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 3 of the License, or (at your option) any later version. It is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this software. If not, see . !  <"p""uudummy m_size called out of %s memory while allocating %u bytes (this may be caused by too many secret keys used simultaneously or due to excessive large key sizes) secmem usage: %u/%u bytes in %u/%u blocks of pool %lu/%lu WARNING: using insecure memory! please see http://www.gnupg.org/faq.html for more information operation is not possible without initialized secure memory (you may have used the wrong program for this task) secure memory corrupted at block %p can't mmap pool of %u bytes: %s - using malloc can't allocate memory pool of %u bytes Oops, secure memory pool already initialized failed to drop setuid secure memory is disabledfailed to reset uid: %s can't lock memory: %s unknown packet typeunknown versionunknown pubkey algorithmunknown digest algorithmbad public keybad secret keybad signaturechecksum errorbad passphrasepublic key not foundunknown cipher algorithmcan't open the keyringinvalid packetinvalid armorno such user idsecret key not availablewrong secret key usedbad keyfile read errorfile write errorunknown compress algorithmfile open errorfile create errorinvalid passphraseunknown signature classtrust database errorbad MPIresource limitinvalid keyringbad certificatemalformed user idfile close errorfile rename errorfile delete errorunexpected datatimestamp conflictunusable pubkey algorithmfile existsweak keyinvalid argumentbad URIunsupported URInetwork errorselftest failednot encryptednot processedunusable public keyunusable secret keykeyserver errorcanceledno datag10err=%dunimplemented pubkey algorithmunimplemented cipher algorithm1' }si_UKA7-#yohaZSLE>70)"fd_cache_invalidate (all) fd_cache_invalidate (%s) did (%s) ../../util/iobuf.c%s: read error: %s %s: write error: %s file_filter(fd)%s: close fd %d fd_cache_close (%d) real fstat() failed: %s a->d.start == a->d.leniobuf-%d.%d: error IOBUFCTRL_FREE failed: %s iobuf-%d.%d: underflow: eof a->d.start == 1flush on non-output iobuf iobuf_flush: no filter a->d.len < a->d.sizea->buflen <= 512c <= 0x1fn == 512!a->buflennbytes < 512init block_filter %p block_filterblock_filter: pending bytes! free block_filter %p iobuf-%d.%d: push `%s' IOBUFCTRL_INIT failed: %s [all]iobuf-*.*: ioctl `%s' fsync fd_cache_synchronize (%s) r+biobuf-%d.%d: openrw `%s' [fd %d]iobuf-%d.%d: fdopen `%s' iobuf-%d.%d: create `%s' iobuf_close -> %p iobuf-%d.%d: close `%s' iobuf-%d.%d: pop `%s' iobuf-%d.%d: popped filter a->use == 1 || a->use == 2can't seek: %s can't lseek: %s can't rewind fd %d: %s iobuf-%d.%d: open `%s' fd=%d iobuf chain: %d.%d `%s' filter_eof=%d start=%d len=%d fd_cache_close (%s) used existing slot fd_cache_close (%s) new slot created iobuf-%d.%d: pop `%s' in underflow iobuf-%d.%d: underflow: eof (due to filter eof) iobuf-%d.%d: underflow: req=%lu iobuf-%d.%d: underflow: got=%lu rc=%d iobuf-%d.%d: pop in underflow (!len) iobuf-%d.%d: underflow: eof (no filter) increasing temp iobuf from %lu to %lu iobuf_flush did not write all! block_filter: 1st length byte missing block_filter: 2nd length byte missing block_filter: invalid 4 byte length block_filter %p: read error (size=%lu,a->size=%lu) block_filter: write error: %s iobuf-%d.%d: ioctl `%s' keep=%d iobuf-*.*: ioctl `%s' invalidate iobuf-%d.%d: ioctl `%s' no_cache=%d iobuf_flush failed on close: %s IOBUFCTRL_FREE failed on close: %s iobuf_flush failed in pop_filter: %s can't remove the last filter from the chain Ohh jeee, trying to remove a head filter Ohh jeee, trying to remove an intermediate filter pop_filter(): filter function not found pop_filter called in set_partial_block_mode - please report pop_filter called in iobuf_seek - please report fd_cache_open (%s) using cached fp fd_cache_open (%s) not cached iobuf_set_partial_block_modepop_filterpop_filterblock_filterblock_filterfile_filteriobuf_writeiobuf_writebyteiobuf_writebyteiobuf_peekunderflowiobuf_push_filter2error opening lockfile `%s': %s invalid pid %d in lockfile `%s'release_dotlock: lockfile error release_dotlock: not our lock (pid=%d) release_dotlock: error removing lockfile `%s'lock not made: link() failed: %s Oops: lock already held by us removing stale lockfile (created by %d) waiting for lock (held by %d%s) %s... failed to create temporary file `%s': %s error reading lockfile `%s'invalid size of lockfile `%s'oops, `%s' is not locked oops, `%s' is already locked cannot read lockfile lockfile disappeared (deadlock?) %10d %.*s/.#lk%p.%n%s.%derror writing to `%s': %s v=pka1fpr=uri=../../util/convert.chex2str_alloc../../util/estream-printf.cargidx < argspecs_len!"bug"0123456789ABCDEF0123456789abcdef0X(null)0123456789abcdefxparm.usedvaluetable[arg->width_pos-1].vt == VALTYPE_INTvaluetable[arg->precision_pos-1].vt == VALTYPE_INTarg->vt == valuetable[arg->arg_pos-1].vtcC`C`cC`C`C`cC`C`C`cC`cC`C``cf```````````````````````````uf``f`Bf```````-f`````fj`j`_jnj}j```````````j````'k````````6k`EkTkckrkk`Tk```kjj k``k`j``jvbfggggfffffffffdfd(gikkkkkkkkkkkllkkkkkkkkkkkkkkkfrrrrrkkgurerUrEr5rkk5g%rrrqqqq'pooooo]o]o]o]o]o]o]o]onmzmmKpmwawUwIw=w1wuyw}umsmsmtmmmmtsmutKussutsswmumum_ummmm_umsuestream_vasprintfdo_format fatal: too many args for xstrconcat fatal: out of memory %s[%u.%p] DBG: -> [Confidential data not shown]../../util/assuan-buffer.catticlen < 1002ctx->inbound.eof%s[%u.%p] DBG: <- [EOF] %s[%u.%p] DBG: <- %s[%u.%p] DBG: -> [supplied line too long -truncated] %s[%u.%p] DBG: -> [supplied line contained a LF -truncated] %s[%u.%p] DBG: <- [Error: %s] %s[%u.%p] DBG: <- [Invalid line] _assuan_read_lineno errorproblem starting servernot a servernot a clientnested commandsinvalid responseno data callbackno inquire callbackconnect failedaccept failednot implementedserver faultinvalid commandunknown commandsyntax errorparameter errorparameter conflictline not terminatedno inputno outputunsupported algorithmserver resource problemserver io errorserver bugno data availableunexpected commandtoo much datainquire unknowninquire errorinvalid optioninvalid indexunexpected statusinvalid statuslocale problemnot confirmeduser error firstuser error lastec=%u.%uec=%dcan't create socket: %s can't connect to server: %s BYEHw@0(;  f<g\h|zR| erAB K<(g(AB N\8h8AB NYA=e'  |o z _ĠXoԟoo2c^:JZjzʧڧ *:JZjzʨڨ *:JZjzʩک *:JZjzʪڪ *:JZjzʫګ *:JZjzʬڬ *:JZjzʭڭ *:JZjzʮڮ *:JZjzʯگ *:JZjzʰڰ *:JZjzʱڱ *:JZjzʲڲ,sybceøи޸cq,޸d޸0  ޸-7A޸R\uA=`Kʹ۹ T x' :CVa޸nuϺۺ޸޸޸3.޸0w:1PZ2p{޸޸޸޸(`޸*»޸$.Ի#޸%޸+޸+޸, ޸,޸! %޸-/޸-:a)Ga޸rcR޸rz޸J޸K޸L޸޸޸ ޸޸˼޸uټ(zLj޸k޸l޸t޸34)޸58޸65޸7?޸8U޸9R޸:d޸;{޸<x޸=޸>޸?޸@޸o\ҽ޸vIIqݽ޸~޸޸޸޸޸޸ ޸޸޸n<7)iAMj޸g޸t޸޸C޸D޸E*޸F޸G޸H޸I޸޸޸Ǿ޸־޸޸޸޸ ޸M޸N޸O޸Q!޸R+޸S7޸TD޸V޸S޸Wb޸Xs޸Y޸޸Z޸[#޸[޸[޸[޸[ƿ޸\#޸]#޸^ο޸_Tֿ`#ta#޸b#޸c#޸d޸e޸޸ ޸޸+޸5޸f޸g޸hH޸iY޸ig޸޸޸x޸޸~޸޸޸N޸N޸޸޸./)t޸"޸&޸.޸k޸m()޸n޸o޸p޸q!޸r,޸s9޸tF޸uQ޸v^޸w*޸xp޸y޸z޸{޸{޸|޸}޸޸޸޸޸޸޸޸!޸+޸7޸E޸=S޸l޸y޸޸޸޸޸޸޸޸޸޸I޸޸޸?޸t޸l޸^޸U޸V޸V޸ ޸޸޸1޸;޸I޸T޸^޸m޸j޸޸޸B޸޸޸޸޸޸޸β޸޸g޸޸ ޸޸'޸<޸N޸_޸p޸޸޸޸z޸޸޸޸޸޸޸޸ ޸"޸ <޸/޸Z޸o޸޸޸޸޸޸ ޸޸7޸?޸G޸O޸X޸f޸d޸l޸y޸v޸޸޸޸޸޸޸޸޸޸޸޸P!޸3޸O޸[޸k޸h޸u޸r޸޸޸޸޸޸޸ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/010  `He 0Q0  `He@0A0  `He0010  `He 0-0  `He0!0 +0!0 +$@d etieidi*ej:e0jUehjie j %)+/5;=CGIOSYaegkmq %379=KQ[]agou{  #-39;AKQWY_eikw)+57;=GUY[_mqsw %'-?CEIOU]ci  ')/QW]ew #+/=AGIMSU[ey '7EKOQUWamsy!#')3?AQSY]_iq   # % + / 5 C I M O U Y _ k q w   ! 1 9 = I W a c g o u {      # ) - ? G Q W ] e o {   % / 1 A [ _ a m s w      ! + - = ? O U i y !'/5;KWY]kqu}  %)1CGMOSY[gk!%+9=?Qisy{ '-9EGY_cio #)+17AGS_qsy} '-7CEIOW]gim{0 0 *H 0!0 +$0!0 +0-0  `He010  `He 0A0  `He00Q0  `He@P0gpgʇ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink TThh !$8\4o>  FzNo22[oԟj Ġ Xs ! |&0w$$' 2 ||- -  B $B |^ ^ ^ ^ _ _ c < @<  < D